Western Blot (WB)
(Host: RabbitTarget Name: OASL2Sample Tissue: Rat Brain lysatesAntibody Dilution: 1ug/ml)
Rabbit anti-Rat OASL2 Polyclonal Antibody | anti-OASL2 antibody
OASL2 Antibody - middle region
Gene Names
Oasl2; Oasl; M1204; Mmu-OASL
Reactivity
Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
OASL2; Polyclonal Antibody; OASL2 Antibody - middle region; anti-OASL2 antibody
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VRNFLKKQLKGDRPIILDPADPTNNLGRRKGWEQVAAEAAFCLLQVCCTT
Sequence Length
511
Applicable Applications for anti-OASL2 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of rat OASL2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: OASL2Sample Tissue: Rat Brain lysatesAntibody Dilution: 1ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: OASL2Sample Tissue: Rat Brain lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-OASL2 antibody
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Synthesizes oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L (By similarity).
Product Categories/Family for anti-OASL2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
59 kDa
NCBI Official Full Name
2'-5'-oligoadenylate synthase-like protein 2 isoform 1
NCBI Official Synonym Full Names
2'-5' oligoadenylate synthetase-like 2
NCBI Official Symbol
Oasl2
NCBI Official Synonym Symbols
Oasl; M1204; Mmu-OASL
NCBI Protein Information
2'-5'-oligoadenylate synthase-like protein 2
UniProt Protein Name
2'-5'-oligoadenylate synthase-like protein 2
Protein Family
UniProt Gene Name
Oasl2
UniProt Entry Name
OASL2_RAT
Uniprot Description
Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. Synthesizes oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L ().
Similar Products
Product Notes
The OASL2 oasl2 (Catalog #AAA3223747) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OASL2 Antibody - middle region reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OASL2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OASL2 oasl2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VRNFLKKQLK GDRPIILDPA DPTNNLGRRK GWEQVAAEAA FCLLQVCCTT. It is sometimes possible for the material contained within the vial of "OASL2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
