Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Tumor necrosis factor alpha-induced protein 8 Recombinant Protein | TNFAIP8 recombinant protein

Recombinant Human Tumor necrosis factor alpha-induced protein 8

Gene Names
TNFAIP8; NDED; GG2-1; SCCS2; SCC-S2; MDC-3.13
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Tumor necrosis factor alpha-induced protein 8; Recombinant Human Tumor necrosis factor alpha-induced protein 8; Head and neck tumor and metastasis-related protein; MDC-3.13; NF-kappa-B-inducible DED-containing protein; NDEDSCC-S2TNF-induced protein GG2-1; TNFAIP8 recombinant protein
Ordering
For Research Use Only!
Host
E Coli
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Liquid containing glycerol
Sequence Positions
2-198aa; Full Length
Sequence
HSEAEESKEVATDVFNSKNLAVQAQKKILGKMVSKSIATTLIDDTSSEVLDELYRVTREYTQNKKEAEKIIKNLIKTVIKLAILYRNNQFNQDELALMEKFKKKVHQLAMTVVSFHQVDYTFDRNVLSRLLNECREMLHQIIQRHLTAKSHGRVNNVFDHFSDCEFLAALYNPFGNFKPHLQKLCDGINKMLDEENI
Sequence Length
188
Preparation and Storage
Store at -20 degree C, for extended storage, conserve at -20 degree C or -80 degree C.

SDS-PAGE

SDS-PAGE
Related Product Information for TNFAIP8 recombinant protein
Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation.
Product Categories/Family for TNFAIP8 recombinant protein
References
Vascular endothelial genes that are responsive to tumor necrosis factor-alpha in vitro are expressed in atherosclerotic lesions, including inhibitor of apoptosis protein-1, stannin, and two novel genes.Horrevoets A.J.G., Fontijn R.D., van Zonneveld A.J., de Vries C.J.M., ten Cate J.W., Pannekoek H.Blood 93:3418-3431(1999)

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49.9 kDa
NCBI Official Full Name
tumor necrosis factor alpha-induced protein 8 isoform b
NCBI Official Synonym Full Names
TNF alpha induced protein 8
NCBI Official Symbol
TNFAIP8
NCBI Official Synonym Symbols
NDED; GG2-1; SCCS2; SCC-S2; MDC-3.13
NCBI Protein Information
tumor necrosis factor alpha-induced protein 8
UniProt Protein Name
Tumor necrosis factor alpha-induced protein 8
UniProt Gene Name
TNFAIP8
UniProt Synonym Gene Names
TNF alpha-induced protein 8; NDED
UniProt Entry Name
TFIP8_HUMAN

Uniprot Description

TNFAIP8: Acts as a negative mediator of apoptosis and may play a role in tumor progression. Suppresses the TNF-mediated apoptosis by inhibiting caspase-8 activity but not the processing of procaspase-8, subsequently resulting in inhibition of BID cleavage and caspase-3 activation. Belongs to the TNFAIP8 family. 3 isoforms of the human protein are produced by alternative splicing.

Chromosomal Location of Human Ortholog: 5q23.1

Cellular Component: cytoplasm

Molecular Function: caspase inhibitor activity; protein binding

Biological Process: defense response to Gram-positive bacterium; interleukin-1 beta production; negative regulation of apoptosis; negative regulation of caspase activity

Research Articles on TNFAIP8

Similar Products

Product Notes

The TNFAIP8 tnfaip8 (Catalog #AAA956964) is a Recombinant Protein produced from E Coli and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 2-198aa; Full Length. The amino acid sequence is listed below: HSEAEESKEV ATDVFNSKNL AVQAQKKILG KMVSKSIATT LIDDTSSEVL DELYRVTREY TQNKKEAEKI IKNLIKTVIK LAILYRNNQF NQDELALMEK FKKKVHQLAM TVVSFHQVDY TFDRNVLSRL LNECREMLHQ IIQRHLTAKS HGRVNNVFDH FSDCEFLAAL YNPFGNFKPH LQKLCDGINK MLDEENI. It is sometimes possible for the material contained within the vial of "Tumor necrosis factor alpha-induced protein 8, Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.