Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)

Rabbit OAS2 Polyclonal Antibody | anti-OAS2 antibody

OAS2 antibody - N-terminal region

Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
OAS2; Polyclonal Antibody; OAS2 antibody - N-terminal region; anti-OAS2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DEMVNTICDVLQEPEQFPLVQGVAIGGSYGRKTVLRGNSDGTLVLFFSDL
Sequence Length
687
Applicable Applications for anti-OAS2 antibody
Western Blot (WB)
Homology
Cow: 92%; Dog: 100%; Horse: 100%; Human: 100%; Pig: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human OAS2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)

Western Blot (WB) (WB Suggested Anti-OAS2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: SH-SYSY cell lysate)
Related Product Information for anti-OAS2 antibody
This is a rabbit polyclonal antibody against OAS2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OAS2 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
79kDa
NCBI Official Full Name
2'-5'-oligoadenylate synthase 2 isoform 2
NCBI Official Synonym Full Names
2'-5'-oligoadenylate synthetase 2
NCBI Official Symbol
OAS2
NCBI Protein Information
2'-5'-oligoadenylate synthase 2
UniProt Protein Name
2'-5'-oligoadenylate synthase 2
UniProt Gene Name
OAS2
UniProt Synonym Gene Names
(2-5')oligo(A) synthase 2; 2-5A synthase 2; p69OAS / p71OAS
UniProt Entry Name
OAS2_HUMAN

NCBI Description

This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, Jul 2008]

Uniprot Description

OAS2: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. Belongs to the 2-5A synthase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.7.7.84; Transferase

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: mitochondrion; intracellular membrane-bound organelle; membrane; endoplasmic reticulum; perinuclear region of cytoplasm; cytoplasm; nucleus; cytosol

Molecular Function: zinc ion binding; metal ion binding; double-stranded RNA binding; ATP binding; 2'-5'-oligoadenylate synthetase activity

Biological Process: cytokine and chemokine mediated signaling pathway; response to virus; RNA catabolic process; nucleobase, nucleoside, nucleotide and nucleic acid metabolic process; protein myristoylation; protein amino acid glycosylation; purine nucleotide biosynthetic process; defense response to virus

Research Articles on OAS2

Similar Products

Product Notes

The OAS2 oas2 (Catalog #AAA3205509) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The OAS2 antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's OAS2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the OAS2 oas2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEMVNTICDV LQEPEQFPLV QGVAIGGSYG RKTVLRGNSD GTLVLFFSDL. It is sometimes possible for the material contained within the vial of "OAS2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.