Rabbit anti-Human OAS1 Polyclonal Antibody | anti-OAS1 antibody

OAS1 antibody - C-terminal region

Cat. Num. AAA3210331

• Gene Names: OAS1; OIAS; IFI-4; OIASI; E18/E16
• Reactivity: Human
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: OAS1; Polyclonal Antibody; OAS1 antibody - C-terminal region; anti-OAS1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: GWRQLAQEAEAWLNYPCFKNWDGSPVSSWILLVRPPASSLPFIPAPLHEA
• Sequence Length: 364

• Applicable Applications for anti-OAS1 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Human: 100%
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human OAS1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Immunohistochemistry of formalin fixed, paraffin-embeddedhumanTonsil tissue. PrimaryAntibody concentration 5 ug/ml.)

Western Blot (WB)

(WB Suggested Anti-OAS1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human heart)

Related Product Information for anti-OAS1 antibody

This is a rabbit polyclonal antibody against OAS1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: OAS1 is a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. It is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Mutations in this gene have been associated with host susceptibility to viral infection.This gene encodes a member of the 2-5A synthetase family, essential proteins involved in the innate immune response to viral infection. The encoded protein is induced by interferons and uses adenosine triphosphate in 2'-specific nucleotidyl transfer reactions to synthesize 2',5'-oligoadenylates (2-5As). These molecules activate latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. The three known members of this gene family are located in a cluster on chromosome 12. Mutations in this gene have been associated with host susceptibility to viral infection. Alternatively spliced transcript variants encoding different isoforms have been described.

Product Categories/Family for anti-OAS1 antibody

Polyclonal; RNA Binding Proteins; Lymphocyte Signaling; Chromatin & Nuclear Signaling; Disease Related; Immunohistochemistry

NCBI and Uniprot Product Information

• NCBI GI #: 74229011
• NCBI GeneID: 4938
• NCBI Accession #: NP_002525
• NCBI GenBank Nucleotide #: NM_002534
• UniProt Accession #: P00973
• Molecular Weight: 42kDa
• NCBI Official Full Name: 2'-5'-oligoadenylate synthase 1 isoform 2
• NCBI Official Synonym Full Names: 2'-5'-oligoadenylate synthetase 1
• NCBI Official Symbol: OAS1
• NCBI Official Synonym Symbols: OIAS; IFI-4; OIASI; E18/E16
• NCBI Protein Information: 2'-5'-oligoadenylate synthase 1
• UniProt Protein Name: 2'-5'-oligoadenylate synthase 1
• Protein Family: 2'-5'-oligoadenylate synthase
• UniProt Gene Name: OAS1
• UniProt Synonym Gene Names: OIAS; (2-5')oligo(A) synthase 1; 2-5A synthase 1
• UniProt Entry Name: OAS1_HUMAN

NCBI Description

This gene is induced by interferons and encodes a protein that synthesizes 2',5'-oligoadenylates (2-5As). This protein activates latent RNase L, which results in viral RNA degradation and the inhibition of viral replication. Alternative splicing results in multiple transcript variants with different enzymatic activities. Polymorphisms in this gene have been associated with susceptibility to viral infection and diabetes mellitus, type 1. A disease-associated allele in a splice acceptor site influences the production of the p46 splice isoform. This gene is located in a cluster of related genes on chromosome 12. [provided by RefSeq, Feb 2016]

Uniprot Description

OAS1: Interferon-induced, dsRNA-activated antiviral enzyme which plays a critical role in cellular innate antiviral response. In addition, it may also play a role in other cellular processes such as apoptosis, cell growth, differentiation and gene regulation. Synthesizes higher oligomers of 2'-5'-oligoadenylates (2-5A) from ATP which then bind to the inactive monomeric form of ribonuclease L (RNase L) leading to its dimerization and subsequent activation. Activation of RNase L leads to degradation of cellular as well as viral RNA, resulting in the inhibition of protein synthesis, thus terminating viral replication. Can mediate the antiviral effect via the classical RNase L-dependent pathway or an alternative antiviral pathway independent of RNase L. The secreted form displays antiviral effect against vesicular stomatitis virus (VSV), herpes simplex virus type 2 (HSV-2), and encephalomyocarditis virus (EMCV) and stimulates the alternative antiviral pathway independent of RNase L. Belongs to the 2-5A synthase family. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Transferase; EC 2.7.7.84

Chromosomal Location of Human Ortholog: 12q24.2

Cellular Component: mitochondrion; endoplasmic reticulum; cytoplasm; extracellular region; cytosol; nucleus

Molecular Function: protein binding; zinc ion binding; metal ion binding; double-stranded RNA binding; ATP binding; 2'-5'-oligoadenylate synthetase activity

Biological Process: negative regulation of viral genome replication; response to virus; cytokine and chemokine mediated signaling pathway; glucose metabolic process; purine nucleotide biosynthetic process; glucose homeostasis; defense response to virus; protein oligomerization

Disease: Diabetes Mellitus, Insulin-dependent