Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-NXF1AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Rabbit NXF1 Polyclonal Antibody | anti-NXF1 antibody

NXF1 antibody - N-terminal region

Gene Names
NXF1; TAP; MEX67
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
NXF1; Polyclonal Antibody; NXF1 antibody - N-terminal region; anti-NXF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MADEGKSYSEHDDERVNFPQRKKKGRGPFRWKYGEGNRRSGRGGSGIRSS
Sequence Length
619
Applicable Applications for anti-NXF1 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 83%; Guinea Pig: 92%; Human: 100%; Mouse: 92%; Rat: 92%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NXF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-NXF1AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Immunohistochemistry (IHC) (Rabbit Anti-NXF1AntibodyParaffin Embedded Tissue: Human KidneyCellular Data: Epithelial cells of renal tubuleAntibody Concentration: 4.0-8.0 ug/mlMagnification: 400X)

Western Blot (WB)

(Lanes:Lane 1: 7ug HeLa lysate+EGFP SiRNALane 2: 7ug HeLa lysate+NXF1 SiRNAPrimary Antibody Dilution:1:300Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NXF1Submitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto UniversityNXF1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (Lanes:Lane 1: 7ug HeLa lysate+EGFP SiRNALane 2: 7ug HeLa lysate+NXF1 SiRNAPrimary Antibody Dilution:1:300Secondary Antibody:Anti-rabbit-HRPSecondary Antibody Dilution:1:500Gene Name:NXF1Submitted by:Seiji Masuda, Kitashirakawa Oiwakecho, Kyoto UniversityNXF1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB)

(WB Suggested Anti-NXF1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateNXF1 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-NXF1 Antibody Titration: 1.25ug/mlPositive Control: HepG2 cell lysateNXF1 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-NXF1 antibody
This is a rabbit polyclonal antibody against NXF1. It was validated on Western Blot and immunohistochemistry

Target Description: NXF1 is one member of a family of nuclear RNA export factor. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. NXF1 shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. NXF1 overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68kDa
NCBI Official Full Name
nuclear RNA export factor 1 isoform 1
NCBI Official Synonym Full Names
nuclear RNA export factor 1
NCBI Official Symbol
NXF1
NCBI Official Synonym Symbols
TAP; MEX67
NCBI Protein Information
nuclear RNA export factor 1
UniProt Protein Name
Nuclear RNA export factor 1
Protein Family
UniProt Gene Name
NXF1
UniProt Synonym Gene Names
TAP
UniProt Entry Name
NXF1_HUMAN

NCBI Description

This gene is one member of a family of nuclear RNA export factor genes. Common domain features of this family are a noncanonical RNP-type RNA-binding domain (RBD), 4 leucine-rich repeats (LRRs), a nuclear transport factor 2 (NTF2)-like domain that allows heterodimerization with NTF2-related export protein-1 (NXT1), and a ubiquitin-associated domain that mediates interactions with nucleoporins. The LRRs and NTF2-like domains are required for export activity. Alternative splicing seems to be a common mechanism in this gene family. The encoded protein of this gene shuttles between the nucleus and the cytoplasm and binds in vivo to poly(A)+ RNA. It is the vertebrate homologue of the yeast protein Mex67p. The encoded protein overcomes the mRNA export block caused by the presence of saturating amounts of CTE (constitutive transport element) RNA of type D retroviruses. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2008]

Uniprot Description

NXF1: Involved in the nuclear export of mRNA species bearing retroviral constitutive transport elements (CTE) and in the export of mRNA from the nucleus to the cytoplasm. The NXF1-NXT1 heterodimer is involved in the export of HSP70 mRNA in conjunction with ALYREF/THOC4 and THOC5. Belongs to the NXF family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA-binding

Chromosomal Location of Human Ortholog: 11q12-q13

Cellular Component: nucleoplasm; nuclear speck; nuclear pore; cytosol; nuclear inclusion body

Molecular Function: mRNA binding; protein binding; nucleotide binding; nucleocytoplasmic transporter activity

Biological Process: mRNA export from nucleus; poly(A)+ mRNA export from nucleus; viral reproduction; gene expression

Research Articles on NXF1

Similar Products

Product Notes

The NXF1 nxf1 (Catalog #AAA3205380) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NXF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NXF1 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NXF1 nxf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MADEGKSYSE HDDERVNFPQ RKKKGRGPFR WKYGEGNRRS GRGGSGIRSS. It is sometimes possible for the material contained within the vial of "NXF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.