Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CEP63Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human CEP63 Polyclonal Antibody | anti-CEP63 antibody

CEP63 Antibody - middle region

Gene Names
CEP63; SCKL6
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
CEP63; Polyclonal Antibody; CEP63 Antibody - middle region; anti-CEP63 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MTMEYKQELKKLHEELCILKRSYEKLQKKQMREFRGNTKNHREDRSEIER
Sequence Length
541
Applicable Applications for anti-CEP63 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CEP63
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CEP63Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CEP63Sample Tissue: Human HepG2 Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-CEP63 antibody
This gene encodes a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. Several alternatively spliced transcript variants have been found, but their biological validity has not been determined.
Product Categories/Family for anti-CEP63 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
59 kDa
NCBI Official Full Name
centrosomal protein of 63 kDa isoform c
NCBI Official Synonym Full Names
centrosomal protein 63
NCBI Official Symbol
CEP63
NCBI Official Synonym Symbols
SCKL6
NCBI Protein Information
centrosomal protein of 63 kDa
UniProt Protein Name
Centrosomal protein of 63 kDa
Protein Family
UniProt Gene Name
CEP63
UniProt Synonym Gene Names
Cep63
UniProt Entry Name
CEP63_HUMAN

NCBI Description

This gene encodes a protein with six coiled-coil domains. The protein is localized to the centrosome, a non-membraneous organelle that functions as the major microtubule-organizing center in animal cells. Several alternatively spliced transcript variants have been found, but their biological validity has not been determined. [provided by RefSeq, Jul 2008]

Uniprot Description

Function: Required for normal spindle assembly. Maintains centrosome numbers through centrosomal recruitment of CEP152. Also recruits CDK1 to centrosomes. Plays a role in DNA damage response. Following DNA damage, such as double-strand breaks (DSBs), is removed from centrosomes; this leads to the inactivation of spindle assembly and delay in mitotic progression

By similarity. Ref.5 Ref.6

Subunit structure: Interacts with CEP152 and CDK1; these interactions recruit both ligands to centrosomes. May also interact with CDK2. Ref.5 Ref.6

Subcellular location: Cytoplasm › cytoskeleton › microtubule organizing center › centrosome. Note: Colocalizes with CEP152 in a discrete ring around the proximal end of the parental centriole. At this site, a cohesive structure is predicted to engage parental centrioles and procentrioles. Ref.4 Ref.5 Ref.6

Involvement in disease: Seckel syndrome 6 (SCKL6) [MIM:614728]: A rare autosomal recessive disorder characterized by proportionate dwarfism of prenatal onset associated with low birth weight, growth retardation, severe microcephaly with a bird-headed like appearance, and mental retardation.Note: The disease is caused by mutations affecting the gene represented in this entry. Ref.6

Sequence similarities: Belongs to the CEP63 family.

Research Articles on CEP63

Similar Products

Product Notes

The CEP63 cep63 (Catalog #AAA3221955) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CEP63 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's CEP63 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CEP63 cep63 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MTMEYKQELK KLHEELCILK RSYEKLQKKQ MREFRGNTKN HREDRSEIER. It is sometimes possible for the material contained within the vial of "CEP63, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.