Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: BORASample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human BORA Polyclonal Antibody | anti-BORA antibody

BORA Antibody - middle region

Gene Names
BORA; C13orf34
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
BORA; Polyclonal Antibody; BORA Antibody - middle region; anti-BORA antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PTFSPIEFQIGETPLSEQRKFTVHSPDASSGTNSNGITNPCIRSPYIDGC
Sequence Length
559
Applicable Applications for anti-BORA antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human BORA
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: BORASample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: BORASample Tissue: Human Jurkat Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-BORA antibody
BORA is an activator of the protein kinase Aurora A, which is required for centrosome maturation, spindle assembly, and asymmetric protein localization during mitosis.
Product Categories/Family for anti-BORA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
61 kDa
NCBI Official Full Name
protein aurora borealis isoform 2
NCBI Official Synonym Full Names
BORA aurora kinase A activator
NCBI Official Symbol
BORA
NCBI Official Synonym Symbols
C13orf34
NCBI Protein Information
protein aurora borealis
UniProt Protein Name
Protein aurora borealis
Protein Family
UniProt Gene Name
BORA
UniProt Synonym Gene Names
C13orf34; HsBora
UniProt Entry Name
BORA_HUMAN

NCBI Description

BORA is an activator of the protein kinase Aurora A (AURKA; MIM 603072), which is required for centrosome maturation, spindle assembly, and asymmetric protein localization during mitosis (Hutterer et al., 2006 [PubMed 16890155]).[supplied by OMIM, Mar 2008]

Uniprot Description

BORA: Required for the activation of AURKA at the onset of mitosis. Interacts with AURKA. Belongs to the BORA family.

Protein type: Activator

Chromosomal Location of Human Ortholog: 13q22.1

Cellular Component: cytosol

Molecular Function: protein binding; protein kinase binding

Biological Process: mitosis; regulation of protein localization; cell division; regulation of mitosis; mitotic cell cycle; G2/M transition of mitotic cell cycle

Research Articles on BORA

Similar Products

Product Notes

The BORA bora (Catalog #AAA3222297) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The BORA Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's BORA can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the BORA bora for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PTFSPIEFQI GETPLSEQRK FTVHSPDASS GTNSNGITNP CIRSPYIDGC. It is sometimes possible for the material contained within the vial of "BORA, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.