Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: CDKN2BSample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

Rabbit CDKN2B Polyclonal Antibody | anti-CDKN2B antibody

CDKN2B antibody - middle region

Gene Names
CDKN2B; P15; MTS2; TP15; CDK4I; INK4B; p15INK4b
Reactivity
Human, Dog, Guinea Pig, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Synonyms
CDKN2B; Polyclonal Antibody; CDKN2B antibody - middle region; anti-CDKN2B antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human, Dog, Guinea Pig, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: REGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEERGHRDVAGYLRTATGD
Sequence Length
138
Applicable Applications for anti-CDKN2B antibody
Western Blot (WB)
Homology
Dog: 91%; Guinea Pig: 83%; Mouse: 83%; Pig: 100%; Rabbit: 91%; Rat: 83%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CDKN2B
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: CDKN2BSample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: CDKN2BSample Tissue: Human Lung TumorAntibody Dilution: 1ug/ml)

Western Blot (WB)

(WB Suggested Anti-CDKN2B Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)

Western Blot (WB) (WB Suggested Anti-CDKN2B Antibody Titration: 0.2-1 ug/mlPositive Control: Jurkat cell lysate)
Related Product Information for anti-CDKN2B antibody
This is a rabbit polyclonal antibody against CDKN2B. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: CDKN2B's gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. CDKN2B is a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
15kDa
NCBI Official Full Name
cyclin-dependent kinase 4 inhibitor B isoform 1
NCBI Official Synonym Full Names
cyclin dependent kinase inhibitor 2B
NCBI Official Symbol
CDKN2B
NCBI Official Synonym Symbols
P15; MTS2; TP15; CDK4I; INK4B; p15INK4b
NCBI Protein Information
cyclin-dependent kinase 4 inhibitor B
UniProt Protein Name
Cyclin-dependent kinase 4 inhibitor B
UniProt Gene Name
CDKN2B
UniProt Synonym Gene Names
MTS2; MTS-2; p15INK4B
UniProt Entry Name
CDN2B_HUMAN

NCBI Description

This gene lies adjacent to the tumor suppressor gene CDKN2A in a region that is frequently mutated and deleted in a wide variety of tumors. This gene encodes a cyclin-dependent kinase inhibitor, which forms a complex with CDK4 or CDK6, and prevents the activation of the CDK kinases, thus the encoded protein functions as a cell growth regulator that controls cell cycle G1 progression. The expression of this gene was found to be dramatically induced by TGF beta, which suggested its role in the TGF beta induced growth inhibition. Two alternatively spliced transcript variants of this gene, which encode distinct proteins, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

p15-INK4B: a potent inhibitor that nteracts strongly with CDK4 and CDK6. Potential effector of TGF-beta induced cell cycle arrest.

Protein type: Cell cycle regulation; Inhibitor; Tumor suppressor; Protein kinase, regulatory subunit

Chromosomal Location of Human Ortholog: 9p21

Cellular Component: nucleoplasm; cytoplasm; cytosol; nucleus

Molecular Function: cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase binding

Biological Process: spleen development; transcription initiation from RNA polymerase II promoter; transcription, DNA-dependent; megakaryocyte differentiation; mitotic cell cycle checkpoint; positive regulation of transforming growth factor beta receptor signaling pathway; cellular response to nutrient; liver development; response to organic cyclic substance; negative regulation of cell proliferation; transforming growth factor beta receptor signaling pathway; response to cytokine stimulus; cellular response to extracellular stimulus; positive regulation of epithelial cell differentiation; negative regulation of phosphorylation; positive regulation of transcription from RNA polymerase II promoter; gene expression; mitotic cell cycle; regulation of cyclin-dependent protein kinase activity; cell cycle arrest; G2/M transition of mitotic cell cycle; negative regulation of epithelial cell proliferation; aging

Research Articles on CDKN2B

Similar Products

Product Notes

The CDKN2B cdkn2b (Catalog #AAA3224393) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CDKN2B antibody - middle region reacts with Human, Dog, Guinea Pig, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CDKN2B can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the CDKN2B cdkn2b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: REGFLDTLVV LHRAGARLDV RDAWGRLPVD LAEERGHRDV AGYLRTATGD. It is sometimes possible for the material contained within the vial of "CDKN2B, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.