Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Recombinant NFkB, Human.)

Rabbit anti-Human Nuclear Factor Kappa B (NFkB) Polyclonal Antibody | anti-NFkB antibody

Polyclonal Antibody to Nuclear Factor Kappa B (NFkB)

Gene Names
NFKB1; p50; KBF1; p105; EBP-1; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B
Reactivity
Human
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
Nuclear Factor Kappa B (NFkB); Polyclonal Antibody; Polyclonal Antibody to Nuclear Factor Kappa B (NFkB); anti-NFkB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against NFkB. It has been selected for its ability to recognize NFkB in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
0.46mg/ml (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-PYLQILEQP KQRGFRFRYV CEGPSHGGLP GASSEKNKKS YPQVKICNYV GPAKVIVQLV TNGKNIHLHA HSLVGKHCED GICTVTAGPK DMVVGFANLG ILHVTKKKVF ETLEARMTEA CIRGYNPGLL VHPDLAYLQA EGGGDRQLGD REKELIRQAA LQQTKEMDLS VVRLMFTAFL PDSTGSFTRR LEPVVSDAIY DSKAPNASNL KIVRMDRTAG CVTGGEEIYL LCDKVQKDDI QIRFYEEEEN GGVWEGFGDF SPTDVHRQFA IVFKTPKYKD INITKPASVF VQLRRKSDLE TSEPKPFLYY PEIKDKEEVQ RKRQKLM
Sequence Length
1095
Applicable Applications for anti-NFkB antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:100-400
Immunocytochemistry in formalin fixed cells: 1:100-500
Immunohistochemistry in formalin fixed frozen section: 1:100-500
Immunohistochemistry in paraffin section: 1:50-200
Enzyme-linked Immunosorbent Assay: 1:100-200
Immunogen
Recombinant NFkB (Pro42~Met367) expressed in E.coli.
Cross Reactivity
Human
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2059577
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Recombinant NFkB, Human.)

Western Blot (WB) (Western Blot: Sample: Recombinant NFkB, Human.)

Immunohistochemistry (IHC)

(DAB staining on fromalin fixed paraffin-embedded Stomach tissue))

Immunohistochemistry (IHC) (DAB staining on fromalin fixed paraffin-embedded Stomach tissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
85,520 Da
NCBI Official Full Name
nuclear factor NF-kappa-B p105 subunit isoform 2 proprotein
NCBI Official Synonym Full Names
nuclear factor kappa B subunit 1
NCBI Official Symbol
NFKB1
NCBI Official Synonym Symbols
p50; KBF1; p105; EBP-1; CVID12; NF-kB1; NFKB-p50; NFkappaB; NF-kappaB; NFKB-p105; NF-kappa-B
NCBI Protein Information
nuclear factor NF-kappa-B p105 subunit
UniProt Protein Name
Nuclear factor NF-kappa-B p105 subunit
UniProt Gene Name
NFKB1

NCBI Description

This gene encodes a 105 kD protein which can undergo cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of the NF-kappa-B (NFKB) protein complex. NFKB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFKB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFKB has been associated with a number of inflammatory diseases while persistent inhibition of NFKB leads to inappropriate immune cell development or delayed cell growth. Alternative splicing results in multiple transcript variants encoding different isoforms, at least one of which is proteolytically processed. [provided by RefSeq, Feb 2016]

Uniprot Description

NFkB-p105: a transcription factor of the nuclear factor-kappaB ( NFkB) group. Undergoes cotranslational processing by the 26S proteasome to produce a 50 kD protein. The 105 kD protein is a Rel protein-specific transcription inhibitor and the 50 kD protein is a DNA binding subunit of NFkB. NFkB is a transcription regulator that is activated by various intra- and extra-cellular stimuli such as cytokines, oxidant-free radicals, ultraviolet irradiation, and bacterial or viral products. Activated NFkB translocates into the nucleus and stimulates the expression of genes involved in a wide variety of biological functions. Inappropriate activation of NFkB has been associated with a number of inflammatory diseases while persistent inhibition of NFkB leads to inappropriate immune cell development or delayed cell growth. There are five NFkB proteins in mammals (RelA/NFkB-p65, RelB, c-Rel, NF-_B1/NFkB-p105, and NF-_B2/NFkB-p100). They form a variety of homodimers and heterodimers, each of which activates its own characteristic set of genes. Two alternatively spliced isoforms have been described.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 4q24

Cellular Component: cytoplasm; cytosol; extracellular region; mitochondrion; nucleoplasm; nucleus; secretory granule lumen

Molecular Function: actinin binding; chromatin binding; DNA binding transcription factor activity; identical protein binding; protein binding; protein heterodimerization activity; protein homodimerization activity; transcription factor binding; transcription regulatory region DNA binding

Biological Process: apoptosis; cellular response to dsRNA; cellular response to interleukin-1; cellular response to interleukin-6; cellular response to nicotine; cellular response to peptide hormone stimulus; cellular response to tumor necrosis factor; Fc-epsilon receptor signaling pathway; I-kappaB kinase/NF-kappaB signaling; inflammatory response; innate immune response; membrane protein intracellular domain proteolysis; negative regulation of apoptosis; negative regulation of calcidiol 1-monooxygenase activity; negative regulation of cellular protein metabolic process; negative regulation of cholesterol transport; negative regulation of gene expression; negative regulation of inflammatory response; negative regulation of interleukin-12 biosynthetic process; negative regulation of transcription from RNA polymerase II promoter; negative regulation of vitamin D biosynthetic process; neutrophil degranulation; NIK/NF-kappaB signaling; positive regulation of canonical Wnt signaling pathway; positive regulation of hyaluronan biosynthetic process; positive regulation of interferon type I production; positive regulation of lipid storage; positive regulation of macrophage derived foam cell differentiation; positive regulation of miRNA metabolic process; positive regulation of NF-kappaB transcription factor activity; positive regulation of transcription from RNA polymerase II promoter; positive regulation of transcription, DNA-templated; response to muscle stretch; stimulatory C-type lectin receptor signaling pathway; stress-activated MAPK cascade; T cell receptor signaling pathway; transcription from RNA polymerase II promoter

Disease: Immunodeficiency, Common Variable, 12

Research Articles on NFkB

Similar Products

Product Notes

The NFkB nfkb1 (Catalog #AAA2002703) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to Nuclear Factor Kappa B (NFkB) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Nuclear Factor Kappa B (NFkB) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:100-400 Immunocytochemistry in formalin fixed cells: 1:100-500 Immunohistochemistry in formalin fixed frozen section: 1:100-500 Immunohistochemistry in paraffin section: 1:50-200 Enzyme-linked Immunosorbent Assay: 1:100-200. Researchers should empirically determine the suitability of the NFkB nfkb1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-PYL QILEQP KQRGFRFRYV CEGPSHGGLP GASSEKNKKS YPQVKICNYV GPAKVIVQLV TNGKNIHLHA HSLVGKHCED GICTVTAGPK DMVVGFANLG ILHVTKKKVF ETLEARMTEA CIRGYNPGLL VHPDLAYLQA EGGGDRQLGD REKELIRQAA LQQTKEMDLS VVRLMFTAFL PDSTGSFTRR LEPVVSDAIY DSKAPNASNL KIVRMDRTAG CVTGGEEIYL LCDKVQKDDI QIRFYEEEEN GGVWEGFGDF SPTDVHRQFA IVFKTPKYKD INITKPASVF VQLRRKSDLE TSEPKPFLYY PEIKDKEEVQ RKRQKLM. It is sometimes possible for the material contained within the vial of "Nuclear Factor Kappa B (NFkB), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.