Mouse ISCU Monoclonal Antibody | anti-ISCU antibody

ISCU (Iron-sulfur cluster scaffold Homolog (E. coli), 2310020H20Rik, HML, ISU2, MGC74517, NIFU, NIFUN, hnifU) (PE)

Cat. Num. AAA6186994

• Gene Names: ISCU; HML; ISU2; NIFU; NIFUN; hnifU; 2310020H20Rik
• Applications: ELISA, Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: ISCU; Monoclonal Antibody; ISCU (Iron-sulfur cluster scaffold Homolog (E. coli); 2310020H20Rik; HML; ISU2; MGC74517; NIFU; NIFUN; hnifU) (PE); Iron-sulfur cluster scaffold Homolog (E. coli); hnifU; anti-ISCU antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 3D12-1D10
• Specificity: Recognizes ISCU.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 167

• Applicable Applications for anti-ISCU antibody: ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: ISCU (AAH11906, 26aa-167aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RELSAPARLYHKKVVDHYENPRNVGSLDKTSKNVGTGLVGAPACGDVMKLQIQVDEKGKIVDARFKTFGCGSAIASSSLATEWVKGKTVEEALTIKNTDIAKELCLPPVKLHCSMLAEDAIKAALADYKLKQEPKKGEAEKK
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ISCU on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to ISCU on HeLa cell. [antibody concentration 10 ug/ml])

Related Product Information for anti-ISCU antibody

Iron-sulfur (Fe-S) clusters are necessary for several mitochondrial enzymes and other subcellular compartment proteins. They contain sulfur and iron, and are created via several steps that include cysteine desulfurases, iron donors, chaperones, and scaffold proteins. This gene encodes the two isomeric forms, ISCU1 and ISCU2, of the Fe-S cluster scaffold protein. Mutations in this gene have been found in patients with myopathy with severe exercise intolerance and myoglobinuria. [provided by RefSeq]

Product Categories/Family for anti-ISCU antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 15080288
• NCBI GeneID: 23479
• NCBI Official Full Name: Iron-sulfur cluster scaffold homolog (E. coli)
• NCBI Official Synonym Full Names: iron-sulfur cluster assembly enzyme
• NCBI Official Symbol: ISCU
• NCBI Official Synonym Symbols: HML; ISU2; NIFU; NIFUN; hnifU; 2310020H20Rik
• NCBI Protein Information: iron-sulfur cluster assembly enzyme ISCU, mitochondrial
• Protein Family: Iron-sulfur cluster assembly enzyme

NCBI Description

This gene encodes a component of the iron-sulfur (Fe-S) cluster scaffold. Fe-S clusters are cofactors that play a role in the function of a diverse set of enzymes, including those that regulate metabolism, iron homeostasis, and oxidative stress response. Alternative splicing results in transcript variants encoding different protein isoforms that localize either to the cytosol or to the mitochondrion. Mutations in this gene have been found in patients with hereditary myopathy with lactic acidosis. A disease-associated mutation in an intron may activate a cryptic splice site, resulting in the production of a splice variant encoding a putatively non-functional protein. A pseudogene of this gene is present on chromosome 1. [provided by RefSeq, Feb 2016]