Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NSL1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellNSL1 is supported by BioGPS gene expression data to be expressed in HeLa)

Rabbit anti-Cow, Human NSL1 Polyclonal Antibody | anti-NSL1 antibody

NSL1 antibody - C-terminal region

Gene Names
NSL1; DC8; MIS14; C1orf48
Reactivity
Cow, Human
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NSL1; Polyclonal Antibody; NSL1 antibody - C-terminal region; anti-NSL1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Human
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PALIEQGEGFSQVLRMQPVIHLQRIHQEVFSSCHRKPDAKPENFITQIET
Sequence Length
281
Applicable Applications for anti-NSL1 antibody
Western Blot (WB)
Homology
Cow: 79%; Human: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NSL1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellNSL1 is supported by BioGPS gene expression data to be expressed in HeLa)

Western Blot (WB) (WB Suggested Anti-NSL1 AntibodyTitration: 1.0 ug/mlPositive Control: Hela Whole CellNSL1 is supported by BioGPS gene expression data to be expressed in HeLa)
Related Product Information for anti-NSL1 antibody
This is a rabbit polyclonal antibody against NSL1. It was validated on Western Blot

Target Description: This gene encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. The encoded protein is part of a conserved protein complex that includes two chromodomain-containing proteins and a component of the outer plate of the kinetochore. This protein complex is proposed to bridge centromeric heterochromatin with the outer kinetochore structure. Multiple transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-NSL1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
31kDa
NCBI Official Full Name
kinetochore-associated protein NSL1 homolog isoform 1
NCBI Official Synonym Full Names
NSL1 component of MIS12 kinetochore complex
NCBI Official Symbol
NSL1
NCBI Official Synonym Symbols
DC8; MIS14; C1orf48
NCBI Protein Information
kinetochore-associated protein NSL1 homolog
UniProt Protein Name
Kinetochore-associated protein NSL1 homolog
UniProt Gene Name
NSL1
UniProt Synonym Gene Names
C1orf48
UniProt Entry Name
NSL1_HUMAN

NCBI Description

This gene encodes a protein with two coiled-coil domains that localizes to kinetochores, which are chromosome-associated structures that attach to microtubules and mediate chromosome movements during cell division. The encoded protein is part of a conserved protein complex that includes two chromodomain-containing proteins and a component of the outer plate of the kinetochore. This protein complex is proposed to bridge centromeric heterochromatin with the outer kinetochore structure. Multiple transcript variants encoding different isoforms have been found for this gene. There is a pseudogene of the 3' UTR region of this gene on chromosome X. [provided by RefSeq, Jul 2014]

Uniprot Description

NSL1: Part of the MIS12 complex which is required for normal chromosome alignment and segregation and kinetochore formation during mitosis.

Chromosomal Location of Human Ortholog: 1q41

Cellular Component: nucleus; cytosol; MIS12/MIND type complex

Molecular Function: protein binding

Biological Process: mitosis; cell division; mitotic cell cycle; chromosome segregation

Research Articles on NSL1

Similar Products

Product Notes

The NSL1 nsl1 (Catalog #AAA3215519) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NSL1 antibody - C-terminal region reacts with Cow, Human and may cross-react with other species as described in the data sheet. AAA Biotech's NSL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NSL1 nsl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PALIEQGEGF SQVLRMQPVI HLQRIHQEVF SSCHRKPDAK PENFITQIET. It is sometimes possible for the material contained within the vial of "NSL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.