Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot: Sample: Mouse Liver lysate; Primary Ab: 3ug/ml Rabbit Anti-Rat CRP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Rabbit anti-Rat C Reactive Protein (CRP) Polyclonal Antibody | anti-CRP antibody

Polyclonal Antibody to C Reactive Protein (CRP)

Gene Names
Crp; Aa1249; Ac1262; Ab1-341; Ab2-196; Ac1-114; Ac2-069; Ba2-693
Reactivity
Rat
Applications
Immunocytochemistry, Immunohistochemistry, ELISA, Western Blot
Purity
Affinity Chromatography
Synonyms
C Reactive Protein (CRP); Polyclonal Antibody; Polyclonal Antibody to C Reactive Protein (CRP); anti-CRP antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Rat
Clonality
Polyclonal
Specificity
The antibody is a rabbit polyclonal antibody raised against CRP. It has been selected for its ability to recognize CRP in immunohistochemical staining andwestern blotting.
Purity/Purification
Affinity Chromatography
Form/Format
Supplied as solution form in PBS, pH7.4, containing 0.02% NaN3,50% glycerol.
Concentration
500ug/mL (varies by lot)
Sequence
Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below.
MGSSHHHHHHSSGLVPRGSHMASMTGGQQMGRGSEF-H EDMSKQAFVF PGVSATAYVS LEAESKKPLE AFTVCLYAHA DVSRSFSIFS YATKTSFNEI LLFWTRGQGF SIAVGGPEIL FSASEIPEVP THICATWESA TGIVELWLDG KPRVRKSLQK GYIVGTNASI ILGQEQDSYG GGFDANQSLV GDIGDVNMWD FVLSPEQINA VYVGRVFSPN VLNWRALKYE THGDVFIKPQ LWPLTDCCES
Sequence Length
224
Applicable Applications for anti-CRP antibody
Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB)
Application Notes
Western blotting: 1:50-400
Immunocytochemistry in formalin fixed cells: 1:50-500
Immunohistochemistry in formalin fixed frozen section: 1:50-500
Immunohistochemistry in paraffin section: 1:10-100
Enzyme-linked Immunosorbent Assay: 1:100-200
Optimal working dilutions must be determined by end user.
Immunogen
Recombinant CRP (His20~Ser230) expressed in E.coli.
Immunogen Information
Recombinant CRP (His20~Ser230) with two N-terminal Tags, His-tag and T7-tag expressed in E.coli.
Accession No.
RPA821Ra01
Cross Reactivity
Mouse, Rat
Conjugated Antibody
The APC conjugated antibody version of this item is also available as catalog #MBS2048166
Preparation and Storage
Store at 4 degree C for frequent use. Stored at -20 degree C to -80 degree C in a manual defrost freezer for one year without detectable loss of activity. Avoid repeated freeze-thaw cycles.

Western Blot (WB)

(Western Blot: Sample: Mouse Liver lysate; Primary Ab: 3ug/ml Rabbit Anti-Rat CRP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Western Blot (WB) (Western Blot: Sample: Mouse Liver lysate; Primary Ab: 3ug/ml Rabbit Anti-Rat CRP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody )

Western Blot (WB)

(Western Blot: Sample: Rat Serum; Primary Ab: 3ug/ml Rabbit Anti-Rat CRP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody (#MBS2086047))

Western Blot (WB) (Western Blot: Sample: Rat Serum; Primary Ab: 3ug/ml Rabbit Anti-Rat CRP Antibody Second Ab: 0.2ug/mL HRP-Linked Caprine Anti-Rabbit IgG Polyclonal Antibody (#MBS2086047))

Western Blot (WB)

(Western Blot: Sample: Recombinant protein.)

Western Blot (WB) (Western Blot: Sample: Recombinant protein.)

Immunohistochemistry (IHC)

(DAB staining on IHC-P. Samples: Rat Tissue))

Immunohistochemistry (IHC) (DAB staining on IHC-P. Samples: Rat Tissue))

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
25,468 Da
NCBI Official Full Name
C-reactive protein
NCBI Official Synonym Full Names
C-reactive protein
NCBI Official Symbol
Crp
NCBI Official Synonym Symbols
Aa1249; Ac1262; Ab1-341; Ab2-196; Ac1-114; Ac2-069; Ba2-693
NCBI Protein Information
C-reactive protein
UniProt Protein Name
C-reactive protein
Protein Family
UniProt Gene Name
Crp
UniProt Synonym Gene Names
Ptx1

NCBI Description

glycoprotein of the acute phase response [RGD, Feb 2006]

Uniprot Description

Displays several functions associated with host defense: it promotes agglutination, bacterial capsular swelling, phagocytosis and complement fixation through its calcium-dependent binding to phosphorylcholine. Can interact with DNA and histones and may scavenge nuclear material released from damaged circulating cells ().

Research Articles on CRP

Similar Products

Product Notes

The CRP crp (Catalog #AAA2003208) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Polyclonal Antibody to C Reactive Protein (CRP) reacts with Rat and may cross-react with other species as described in the data sheet. AAA Biotech's C Reactive Protein (CRP) can be used in a range of immunoassay formats including, but not limited to, Immunocytochemistry (ICC), Immunohistochemistry (IHC) - Formalin/Paraffin, ELISA (EIA), Western Blot (WB). Western blotting: 1:50-400 Immunocytochemistry in formalin fixed cells: 1:50-500 Immunohistochemistry in formalin fixed frozen section: 1:50-500 Immunohistochemistry in paraffin section: 1:10-100 Enzyme-linked Immunosorbent Assay: 1:100-200 Optimal working dilutions must be determined by end user. Researchers should empirically determine the suitability of the CRP crp for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Antigen: The target protein is fused with two N-terminal Tags, His-tag and its sequence is listed below. MGSSHHHHHH SSGLVPRGSH MASMTGGQQM GRGSEF-H EDMSKQAFVF PGVSATAYVS LEAESKKPLE AFTVCLYAHA DVSRSFSIFS YATKTSFNEI LLFWTRGQGF SIAVGGPEIL FSASEIPEVP THICATWESA TGIVELWLDG KPRVRKSLQK GYIVGTNASI ILGQEQDSYG GGFDANQSLV GDIGDVNMWD FVLSPEQINA VYVGRVFSPN VLNWRALKYE THGDVFIKPQ LWPLTDCCES. It is sometimes possible for the material contained within the vial of "C Reactive Protein (CRP), Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.