Rabbit anti-Human NRXN1 Polyclonal Antibody | anti-NRXN1 antibody

NRXN1 Antibody - C-terminal region

Cat. Num. AAA3220808

• Gene Names: NRXN1; PTHSL2; SCZD17; Hs.22998
• Reactivity: Human
• Applications: Western Blot
• Purity: Affinity purified
• Synonyms: NRXN1; Polyclonal Antibody; NRXN1 Antibody - C-terminal region; anti-NRXN1 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Purity/Purification: Affinity purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 29% sucrose.
• Sequence: Synthetic peptide located within the following region: RDEGSYHVDESRNYISNSAQSNGAVVKEKQPSSAKSSNKNKKNKDKEYYV
• Sequence Length: 396

• Applicable Applications for anti-NRXN1 antibody: Western Blot (WB)
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human NRXN1
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NRXN1Sample Tissue: Human PRMI 8226 Whole Cell lysatesAntibody Dilution: 1ug/ml)

Related Product Information for anti-NRXN1 antibody

This gene encodes a single-pass type I membrane protein that belongs to the neurexin family. Neurexins are cell-surface receptors that bind neuroligins to form Ca(2+)-dependent neurexin/neuroligin complexes at synapses in the central nervous system. This complex is required for efficient neurotransmission, and is involved in the formation of synaptic contacts. Three members of this gene family have been studied in detail and are estimated to generate over 3,000 variants through the use of two alternative promoters (alpha and beta) and extensive alternative splicing in each family member. Recently, a third promoter (gamma) was identified for this gene in the 3' region. The RefSeq project has decided to create only a few representative transcript variants of the multitude that are possible. Mutations in this gene are associated with Pitt-Hopkins-like syndrome-2.

Product Categories/Family for anti-NRXN1 antibody

Polyclonal; Neurobiology; Signaling Intermediate; Cell Adhesion

NCBI and Uniprot Product Information

• NCBI GI #: 21070967
• NCBI GeneID: 9378
• NCBI Accession #: NP_620072.1
• NCBI GenBank Nucleotide #: NM_004801.4
• UniProt Accession #: A4FVB9; P58400; Q9ULB1
• Molecular Weight: 43 kDa
• NCBI Official Full Name: neurexin-1 isoform beta1
• NCBI Official Synonym Full Names: neurexin 1
• NCBI Official Symbol: NRXN1
• NCBI Official Synonym Symbols: PTHSL2; SCZD17; Hs.22998
• NCBI Protein Information: neurexin-1
• Protein Family: Neurexin

NCBI Description

This gene encodes a single-pass type I membrane protein that belongs to the neurexin family. Neurexins are cell-surface receptors that bind neuroligins to form Ca(2+)-dependent neurexin/neuroligin complexes at synapses in the central nervous system. This complex is required for efficient neurotransmission and is involved in the formation of synaptic contacts. Three members of this gene family have been studied in detail and are estimated to generate over 3,000 variants through the use of two alternative promoters (alpha and beta) and extensive alternative splicing in each family member. Recently, a third promoter (gamma) was identified for this gene in the 3' region. Mutations in this gene are associated with Pitt-Hopkins-like syndrome-2 and may contribute to susceptibility to schizophrenia. [provided by RefSeq, Aug 2016]