Mouse NRXN1 Monoclonal Antibody | anti-NRXN1 antibody

NRXN1 (Neurexin 1, DKFZp313P2036, FLJ35941, Hs.22998, KIAA0578) (AP)

Cat. Num. AAA6162078

• Gene Names: NRXN1; PTHSL2; SCZD17; Hs.22998
• Applications: Western Blot
• Purity: Purified
• Synonyms: NRXN1; Monoclonal Antibody; NRXN1 (Neurexin 1; DKFZp313P2036; FLJ35941; Hs.22998; KIAA0578) (AP); Neurexin 1; KIAA0578; anti-NRXN1 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4F7
• Specificity: Recognizes NRXN1.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
• Sequence Length: 1477

• Applicable Applications for anti-NRXN1 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: NRXN1 (NP_004792, 31aa-130aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: LEFPGAEGQWTRFPKWNACCESEMSFQLKTRSARGLVLYFDDEGFCDFLELILTRGGRLQLSFSIFCAEPATLLADTPVNDGAWHSVRIRRQFRNTTLFI
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged NRXN1 is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-NRXN1 antibody

Neurexins function in the vertebrate nervous system as cell adhesion molecules and receptors. Two neurexin genes are among the largest known in human (NRXN1 and NRXN3). By using alternate promoters, splice sites and exons, predictions of hundreds or even thousands of distinct mRNAs have been made. Most transcripts use the upstream promoter and encode alpha-neurexin isoforms; fewer transcripts are produced from the downstream promoter and encode beta-neurexin isoforms. Alpha-neurexins contain epidermal growth factor-like (EGF-like) sequences and laminin G domains, and they interact with neurexophilins. Beta-neurexins lack EGF-like sequences and contain fewer laminin G domains than alpha-neurexins. The RefSeq Project has decided to create only a few representative transcript variants of the multitude that are possible. [provided by RefSeq]

Product Categories/Family for anti-NRXN1 antibody

Antibodies; Neuroscience

NCBI and Uniprot Product Information

• NCBI GI #: 14149613
• NCBI GeneID: 9378
• NCBI Accession #: NP_004792
• NCBI GenBank Nucleotide #: NP_004792.1
• UniProt Accession #: Q9ULB1; P58400
• NCBI Official Full Name: neurexin-1 isoform alpha1
• NCBI Official Synonym Full Names: neurexin 1
• NCBI Official Symbol: NRXN1
• NCBI Official Synonym Symbols: PTHSL2; SCZD17; Hs.22998
• NCBI Protein Information: neurexin-1
• UniProt Protein Name: Neurexin-1
• Protein Family: Neurexin
• UniProt Gene Name: NRXN1
• UniProt Synonym Gene Names: KIAA0578
• UniProt Entry Name: NRX1A_HUMAN

NCBI Description

This gene encodes a single-pass type I membrane protein that belongs to the neurexin family. Neurexins are cell-surface receptors that bind neuroligins to form Ca(2+)-dependent neurexin/neuroligin complexes at synapses in the central nervous system. This complex is required for efficient neurotransmission and is involved in the formation of synaptic contacts. Three members of this gene family have been studied in detail and are estimated to generate over 3,000 variants through the use of two alternative promoters (alpha and beta) and extensive alternative splicing in each family member. Recently, a third promoter (gamma) was identified for this gene in the 3' region. Mutations in this gene are associated with Pitt-Hopkins-like syndrome-2 and may contribute to susceptibility to schizophrenia. [provided by RefSeq, Aug 2016]

Uniprot Description

NRXN1: Cell surface protein involved in cell-cell-interactions, excytosis of secretory granules and regulation of signal transmission. Function is isoform-specific. Alpha-type isoforms have a long N-terminus with six laminin G-like domains and play an important role in synaptic signal transmission. Alpha-type isoforms play a role in the regulation of calcium channel activity and Ca(2+)-triggered neurotransmitter release at synapses and at neuromuscular junctions. They play an important role in Ca(2+)- triggered exocytosis of secretory granules in pituitary gland. They may effect their functions at synapses and in endocrine cells via their interactions with proteins from the exocytotic machinery. Likewise, alpha-type isoforms play a role in regulating the activity of postsynaptic NMDA receptors, a subtype of glutamate-gated ion channels. Both alpha-type and beta-type isoforms may play a role in the formation or maintenance of synaptic junctions via their calcium-dependent interactions (via the extracellular domains) with neuroligin family members, CBLN1 or CBLN2. In vitro, triggers the de novo formation of presynaptic structures. May be involved in specification of excitatory synapses. Alpha-type isoforms were first identified as receptors for alpha-latroxin from spider venom. Belongs to the neurexin family. 4 isoforms of the human protein are produced by alternative promoter.

Protein type: Receptor, misc.; Membrane protein, integral

Chromosomal Location of Human Ortholog: 2p16.3

Cellular Component: presynaptic membrane; cell surface; integral to plasma membrane; endocytic vesicle; integral to membrane; plasma membrane; cell junction

Molecular Function: protein binding; metal ion binding; calcium channel regulator activity; acetylcholine receptor binding; receptor activity; calcium ion binding; cell adhesion molecule binding; calcium-dependent protein binding; receptor binding

Biological Process: axon guidance; extracellular matrix organization and biogenesis; prepulse inhibition; neurotransmitter secretion; social behavior; vocal learning; learning; positive regulation of synaptic transmission, glutamatergic; cerebellar granule cell differentiation; negative regulation of filopodium formation; heterophilic cell adhesion; synaptic transmission; positive regulation of synaptogenesis; establishment of protein localization; synaptogenesis; adult behavior; calcium-dependent cell-cell adhesion; neuron adhesion; angiogenesis; neuromuscular process controlling balance

Disease: Pitt-hopkins-like Syndrome 2; Chromosome 2p16.3 Deletion Syndrome