Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NR3C2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Rabbit NR3C2 Polyclonal Antibody | anti-NR3C2 antibody

NR3C2 antibody - C-terminal region

Gene Names
NR3C2; MR; MCR; MLR; NR3C2VIT
Reactivity
Cow, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NR3C2; Polyclonal Antibody; NR3C2 antibody - C-terminal region; anti-NR3C2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: VSDLLEFCFYTFRESHALKVEFPAMLVEIISDQLPKVESGNAKPLYFHRK
Sequence Length
867
Applicable Applications for anti-NR3C2 antibody
Western Blot (WB)
Homology
Cow: 92%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C terminal region of human NR3C2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NR3C2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)

Western Blot (WB) (WB Suggested Anti-NR3C2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Related Product Information for anti-NR3C2 antibody
This is a rabbit polyclonal antibody against NR3C2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NR3C2 is a receptor for both mineralocorticoids (MC) such as aldosterone and glucocorticoids (GC) such as corticosterone or cortisol. It binds to mineralocorticoid response elements (MRE) and transactivates target genes. The effect of MC is to increase ion and water transport and thus raise extracellular fluid volume and blood pressure and lower potassium levels.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
94kDa
NCBI Official Full Name
mineralocorticoid receptor isoform 2
NCBI Official Synonym Full Names
nuclear receptor subfamily 3 group C member 2
NCBI Official Symbol
NR3C2
NCBI Official Synonym Symbols
MR; MCR; MLR; NR3C2VIT
NCBI Protein Information
mineralocorticoid receptor

NCBI Description

This gene encodes the mineralocorticoid receptor, which mediates aldosterone actions on salt and water balance within restricted target cells. The protein functions as a ligand-dependent transcription factor that binds to mineralocorticoid response elements in order to transactivate target genes. Mutations in this gene cause autosomal dominant pseudohypoaldosteronism type I, a disorder characterized by urinary salt wasting. Defects in this gene are also associated with early onset hypertension with severe exacerbation in pregnancy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Oct 2009]

Research Articles on NR3C2

Similar Products

Product Notes

The NR3C2 (Catalog #AAA3224574) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR3C2 antibody - C-terminal region reacts with Cow, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NR3C2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR3C2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: VSDLLEFCFY TFRESHALKV EFPAMLVEII SDQLPKVESG NAKPLYFHRK. It is sometimes possible for the material contained within the vial of "NR3C2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.