Western Blot (WB)
(WB Suggested Anti-Nr2c1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Lung)
Rabbit Nr2c1 Polyclonal Antibody | anti-NR2C1 antibody
Nr2c1 antibody - N-terminal region
Gene Names
Nr2c1; TR2; 80.3; Eenr; Tr2-11; 4831444H07Rik
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Applications
Western Blot
Purity
Affinity Purified
Synonyms
Nr2c1; Polyclonal Antibody; Nr2c1 antibody - N-terminal region; anti-NR2C1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MATIEEIAHQIIDQQMGEIVTEQQTGQKIQIVTALDHSTQGKQFILANHE
Sequence Length
590
Applicable Applications for anti-NR2C1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 92%; Horse: 79%; Human: 79%; Mouse: 100%; Rat: 100%; Yeast: 90%
Immunogen
The immunogen is a synthetic peptide corresponding to a region of Mouse
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-Nr2c1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Lung)
Western Blot (WB)
(WB Suggested Anti-Nr2c1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: Mouse Lung)
Related Product Information for anti-NR2C1 antibody
This is a rabbit polyclonal antibody against Nr2c1. It was validated on Western Blot
Target Description: Nr2c1 is an orphan nuclear receptor. Nr2c1 represses transcription and binds DNA as a homodimer. Nr2c1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism.
Target Description: Nr2c1 is an orphan nuclear receptor. Nr2c1 represses transcription and binds DNA as a homodimer. Nr2c1 binds the IR7 element in the promoter of its own gene in an autoregulatory negative feedback mechanism.
Product Categories/Family for anti-NR2C1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
65kDa
NCBI Official Full Name
nuclear receptor subfamily 2 group C member 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 2, group C, member 1
NCBI Official Symbol
Nr2c1
NCBI Official Synonym Symbols
TR2; 80.3; Eenr; Tr2-11; 4831444H07Rik
NCBI Protein Information
nuclear receptor subfamily 2 group C member 1
UniProt Protein Name
Nuclear receptor subfamily 2 group C member 1
Protein Family
UniProt Gene Name
Nr2c1
UniProt Synonym Gene Names
Tr2
UniProt Entry Name
NR2C1_RAT
Research Articles on NR2C1
Similar Products
Product Notes
The NR2C1 nr2c1 (Catalog #AAA3203478) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The Nr2c1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Yeast and may cross-react with other species as described in the data sheet. AAA Biotech's Nr2c1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NR2C1 nr2c1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MATIEEIAHQ IIDQQMGEIV TEQQTGQKIQ IVTALDHSTQ GKQFILANHE. It is sometimes possible for the material contained within the vial of "Nr2c1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
