Western Blot (WB)
(WB Suggested Anti-ZNF537 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Rabbit ZNF537 Polyclonal Antibody | anti-TSHZ3 antibody
ZNF537 antibody - middle region
Gene Names
TSHZ3; TSH3; ZNF537
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
ZNF537; Polyclonal Antibody; ZNF537 antibody - middle region; anti-TSHZ3 antibody
Host
Rabbit
Reactivity
Cow, Guinea Pig, Horse, Human, Mouse, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: LNVEVKKEVDKEKAVTDEKPKQKDKPGEEEEKCDISSKYHYLTENDLEES
Sequence Length
898
Applicable Applications for anti-TSHZ3 antibody
Western Blot (WB)
Homology
Cow: 79%; Guinea Pig: 79%; Horse: 86%; Human: 100%; Mouse: 85%; Rat: 86%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human ZNF537
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-ZNF537 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Western Blot (WB)
(WB Suggested Anti-ZNF537 Antibody Titration: 0.2-1 ug/mlPositive Control: Human Lung)
Related Product Information for anti-TSHZ3 antibody
This is a rabbit polyclonal antibody against ZNF537. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The ZNF537 gene is located on chromosome 19.
Target Description: The ZNF537 gene is located on chromosome 19.
Product Categories/Family for anti-TSHZ3 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
98kDa
NCBI Official Full Name
teashirt homolog 3
NCBI Official Synonym Full Names
teashirt zinc finger homeobox 3
NCBI Official Symbol
TSHZ3
NCBI Official Synonym Symbols
TSH3; ZNF537
NCBI Protein Information
teashirt homolog 3
Protein Family
NCBI Description
This gene encodes a zinc-finger transcription factor that regulates smooth muscle cell differentiation in the developing urinary tract. Consistent with this role, mice in which this gene has been inactivated exhibit abnormal gene expression in urinary tract smooth muscle cell precursors and kidney defects including hydronephrosis. The encoded transcription factor comprises a gene silencing complex that inhibits caspase expression. Reduced expression of this gene and consequent caspase upregulation may be correlated with progression of Alzheimer's disease in human patients. [provided by RefSeq, Jul 2016]
Research Articles on TSHZ3
Similar Products
Product Notes
The TSHZ3 (Catalog #AAA3201255) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The ZNF537 antibody - middle region reacts with Cow, Guinea Pig, Horse, Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's ZNF537 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSHZ3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: LNVEVKKEVD KEKAVTDEKP KQKDKPGEEE EKCDISSKYH YLTENDLEES. It is sometimes possible for the material contained within the vial of "ZNF537, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
