Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NR1I2 expression in transfected 293T cell line by NR1I2 polyclonal antibody. Lane 1: NR1I2 transfected lysate (49.8kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NR1I2 Polyclonal Antibody | anti-NR1I2 antibody

NR1I2 (Nuclear Receptor Subfamily 1 Group I Member 2, Orphan Nuclear Receptor PAR1, Orphan Nuclear Receptor PXR, Pregnane X Receptor, Steroid and Xenobiotic Receptor, SXR, PXR) (Biotin)

Gene Names
NR1I2; BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NR1I2; Polyclonal Antibody; NR1I2 (Nuclear Receptor Subfamily 1 Group I Member 2; Orphan Nuclear Receptor PAR1; Orphan Nuclear Receptor PXR; Pregnane X Receptor; Steroid and Xenobiotic Receptor; SXR; PXR) (Biotin); anti-NR1I2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NR1I2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-NR1I2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NR1I2, aa1-434 (NP_003880.3).
Immunogen Sequence
MEVRPKESWNHADFVHCEDTESVPGKPSVNADEEVGGPQICRVCGDKATGYHFNVMTCEGCKGFFRRAMKRNARLRCPFRKGACEITRKTRRQCQACRLRKCLESGMKKEMIMSDEAVEERRALIKRKKSERTGTQPLGVQGLTEEQRMMIRELMDAQMKTFDTTFSHFKNFRLPGVLSSGCELPESLQAPSREEAAKWSQVRKDLCSLKVSLQLRGEDGSVWNYKPPADSGGKEIFSLLPHMADMSTYMFKGIISFAKVISYFRDLPIEDQISLLKGAAFELCQLRFNTVFNAETGTWECGRLSYCLEDTAGGFQQLLLEPMLKFHYMLKKLQLHEEEYVLMQAISLFSPDRPGVLQHRVVDQLQEQFAITLKSYIECNRPQPAHRFLFLKIMAMLTELRSINAQHTQRLLRIQDIHPFATPLMQELFGITGS
Conjugate
Biotin
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NR1I2 expression in transfected 293T cell line by NR1I2 polyclonal antibody. Lane 1: NR1I2 transfected lysate (49.8kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NR1I2 expression in transfected 293T cell line by NR1I2 polyclonal antibody. Lane 1: NR1I2 transfected lysate (49.8kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NR1I2 antibody
NR1I2 belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. This protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin.
Product Categories/Family for anti-NR1I2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,762 Da
NCBI Official Full Name
nuclear receptor subfamily 1 group I member 2 isoform 1
NCBI Official Synonym Full Names
nuclear receptor subfamily 1, group I, member 2
NCBI Official Symbol
NR1I2
NCBI Official Synonym Symbols
BXR; PAR; PRR; PXR; SAR; SXR; ONR1; PAR1; PAR2; PARq
NCBI Protein Information
nuclear receptor subfamily 1 group I member 2; pregnane X receptor; orphan nuclear receptor PXR; orphan nuclear receptor PAR1; steroid and xenobiotic receptor; pregnane X nuclear receptor variant 2
UniProt Protein Name
Nuclear receptor subfamily 1 group I member 2
UniProt Gene Name
NR1I2
UniProt Synonym Gene Names
PXR; SXR
UniProt Entry Name
NR1I2_HUMAN

NCBI Description

This gene product belongs to the nuclear receptor superfamily, members of which are transcription factors characterized by a ligand-binding domain and a DNA-binding domain. The encoded protein is a transcriptional regulator of the cytochrome P450 gene CYP3A4, binding to the response element of the CYP3A4 promoter as a heterodimer with the 9-cis retinoic acid receptor RXR. It is activated by a range of compounds that induce CYP3A4, including dexamethasone and rifampicin. Several alternatively spliced transcripts encoding different isoforms, some of which use non-AUG (CUG) translation initiation codon, have been described for this gene. Additional transcript variants exist, however, they have not been fully characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

PXR: Nuclear receptor that binds and is activated by variety of endogenous and xenobiotic compounds. Transcription factor that activates the transcription of multiple genes involved in the metabolism and secretion of potentially harmful xenobiotics, drugs and endogenous compounds. Activated by the antibiotic rifampicin and various plant metabolites, such as hyperforin, guggulipid, colupulone, and isoflavones. Response to specific ligands is species-specific. Activated by naturally occurring steroids, such as pregnenolone and progesterone. Binds to a response element in the promoters of the CYP3A4 and ABCB1/MDR1 genes. Heterodimer with RXR. Interacts with NCOA1. Expressed in liver, colon and small intestine. Belongs to the nuclear hormone receptor family. NR1 subfamily. 7 isoforms of the human protein are produced by alternative splicing.

Protein type: Nuclear receptor; DNA-binding

Chromosomal Location of Human Ortholog: 3q12-q13.3

Cellular Component: nucleoplasm

Molecular Function: protein binding; ligand-dependent nuclear receptor activity; zinc ion binding; transcription coactivator activity; steroid hormone receptor activity; drug binding

Biological Process: steroid metabolic process; transcription initiation from RNA polymerase II promoter; intracellular receptor-mediated signaling pathway; positive regulation of transcription, DNA-dependent; drug export; signal transduction; xenobiotic metabolic process; exogenous drug catabolic process; steroid hormone mediated signaling; positive regulation of transcription from RNA polymerase II promoter; gene expression; xenobiotic transport; negative regulation of transcription, DNA-dependent

Research Articles on NR1I2

Similar Products

Product Notes

The NR1I2 nr1i2 (Catalog #AAA6387416) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NR1I2 (Nuclear Receptor Subfamily 1 Group I Member 2, Orphan Nuclear Receptor PAR1, Orphan Nuclear Receptor PXR, Pregnane X Receptor, Steroid and Xenobiotic Receptor, SXR, PXR) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NR1I2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NR1I2 nr1i2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NR1I2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.