Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: NPY5RSample Tissue: Esophagus Tumor lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human NPY5R Polyclonal Antibody | anti-NPY5R antibody

NPY5R Antibody - N-terminal region

Gene Names
NPY5R; NPYR5; NPY5-R; NPYY5-R
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
NPY5R; Polyclonal Antibody; NPY5R Antibody - N-terminal region; anti-NPY5R antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 23% sucrose.
Sequence
Synthetic peptide located within the following region: DEYYNKTLATENNTAATRNSDFPVWDDYKSSVDDLQYFLIGLYTFVSLLG
Sequence Length
445
Applicable Applications for anti-NPY5R antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the N region of human NPY5R
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NPY5RSample Tissue: Esophagus Tumor lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: NPY5RSample Tissue: Esophagus Tumor lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-NPY5R antibody
The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved in a pathway that protects neuroblastoma cells from chemotherapy-induced cell death, providing a possible therapeutic target against neuroblastoma. Three transcript variants encoding the same protein have been found for this gene.
Product Categories/Family for anti-NPY5R antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
49 kDa
NCBI Official Full Name
neuropeptide Y receptor type 5
NCBI Official Synonym Full Names
neuropeptide Y receptor Y5
NCBI Official Symbol
NPY5R
NCBI Official Synonym Symbols
NPYR5; NPY5-R; NPYY5-R
NCBI Protein Information
neuropeptide Y receptor type 5
UniProt Protein Name
Neuropeptide Y receptor type 5
Protein Family
UniProt Gene Name
NPY5R
UniProt Synonym Gene Names
NPYR5; NPY5-R; NPYY5-R; Y5 receptor
UniProt Entry Name
NPY5R_HUMAN

NCBI Description

The protein encoded by this gene is a receptor for neuropeptide Y and peptide YY. The encoded protein appears to be involved in regulating food intake, with defects in this gene being associated with eating disorders. Also, the encoded protein is involved in a pathway that protects neuroblastoma cells from chemotherapy-induced cell death, providing a possible therapeutic target against neuroblastoma. Three transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Nov 2015]

Uniprot Description

NPY5R: Receptor for neuropeptide Y and peptide YY. The activity of this receptor is mediated by G proteins that inhibit adenylate cyclase activity. Seems to be associated with food intake. Could be involved in feeding disorders. Belongs to the G-protein coupled receptor 1 family.

Protein type: Receptor, GPCR; GPCR, family 1; Membrane protein, multi-pass; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q31-q32

Cellular Component: neuron projection; integral to plasma membrane; cytoplasm; plasma membrane

Molecular Function: peptide YY receptor activity; pancreatic polypeptide receptor activity; neuropeptide Y receptor activity

Biological Process: synaptic transmission; generation of ovulation cycle rhythm; G-protein coupled receptor protein signaling pathway; negative regulation of glutamate secretion; positive regulation of acute inflammatory response; neuropeptide signaling pathway; eating behavior; positive regulation of smooth muscle cell proliferation; negative regulation of synaptic transmission, GABAergic; negative regulation of apoptosis

Research Articles on NPY5R

Similar Products

Product Notes

The NPY5R npy5r (Catalog #AAA3220343) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NPY5R Antibody - N-terminal region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NPY5R can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NPY5R npy5r for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DEYYNKTLAT ENNTAATRNS DFPVWDDYKS SVDDLQYFLI GLYTFVSLLG. It is sometimes possible for the material contained within the vial of "NPY5R, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.