Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NOL7 expression in transfected 293T cell line by NOL7 polyclonal antibody. Lane 1: NOL7 transfected lysate (28.27kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human NOL7 Polyclonal Antibody | anti-NOL7 antibody

NOL7 (C6orf90, NOP27, Nucleolar Protein 7, Nucleolar Protein of 27kD, MGC71933, dJ223E5.2)

Gene Names
NOL7; PQBP3; RARG-1; C6orf90; dJ223E5.2
Reactivity
Human
Applications
Western Blot, Immunofluorescence
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NOL7; Polyclonal Antibody; NOL7 (C6orf90; NOP27; Nucleolar Protein 7; Nucleolar Protein of 27kD; MGC71933; dJ223E5.2); Anti -NOL7 (C6orf90; anti-NOL7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NOL7.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MVQLRPRASRAPASAEAMVDEGQLASEEEEAEHGLLLGQPSSGAAAEPLEEDEEGDDEFDDEAPEELTFASAQAEAREEERRVRETVRRDKTLLKEKRKRREELFIEQKKRKLLPDTILEKLTTASQTNIKKSPGKVKEVNLQKKNEDCEKGNDSKKVKVQKVQSVSQNKSYLAVRLKDQDLRDSRQQAAQAFIHNSLYGPGTNRTTVNKFLSLANKRLPVKRAAVQFLNNAWGIQKKQNAKRFKRRWMVRKMKTKK
Applicable Applications for anti-NOL7 antibody
Western Blot (WB), Immunofluorescence (IF)
Application Notes
Suitable for use in Immunofluorescence and Western Blot.
Dilution: Immunofluorescence: 10ug/ml
Immunogen
Full length human NOL7, aa1-257 (NP_057251).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NOL7 expression in transfected 293T cell line by NOL7 polyclonal antibody. Lane 1: NOL7 transfected lysate (28.27kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NOL7 expression in transfected 293T cell line by NOL7 polyclonal antibody. Lane 1: NOL7 transfected lysate (28.27kD). Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to NOL7 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of purified antibody to NOL7 on HeLa cell. [antibody concentration 10ug/ml].)
Product Categories/Family for anti-NOL7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29,426 Da
NCBI Official Full Name
nucleolar protein 7
NCBI Official Synonym Full Names
nucleolar protein 7, 27kDa
NCBI Official Symbol
NOL7
NCBI Official Synonym Symbols
PQBP3; RARG-1; C6orf90; dJ223E5.2
NCBI Protein Information
nucleolar protein 7; nucleolar protein of 27 kDa; polyglutamine binding protein 3; retinoic acid repressible protein
UniProt Protein Name
Nucleolar protein 7
Protein Family
UniProt Gene Name
NOL7
UniProt Synonym Gene Names
C6orf90; NOP27
UniProt Entry Name
NOL7_HUMAN

Uniprot Description

Subcellular location: Nucleus › nucleolus Ref.1 Ref.6 Ref.7.

Tissue specificity: Expressed in numerous tissues. Particularly prevalent in the adrenal gland, thyroid gland, heart and skeletal muscle. Ref.1

Sequence caution: The sequence CAB43398.1 differs from that shown. Reason: Contaminating sequence. Potential poly-A sequence.The sequence CAI19840.1 differs from that shown. Reason: Erroneous gene model prediction.

Research Articles on NOL7

Similar Products

Product Notes

The NOL7 nol7 (Catalog #AAA649037) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The NOL7 (C6orf90, NOP27, Nucleolar Protein 7, Nucleolar Protein of 27kD, MGC71933, dJ223E5.2) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NOL7 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunofluorescence (IF). Suitable for use in Immunofluorescence and Western Blot. Dilution: Immunofluorescence: 10ug/ml. Researchers should empirically determine the suitability of the NOL7 nol7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MVQLRPRASR APASAEAMVD EGQLASEEEE AEHGLLLGQP SSGAAAEPLE EDEEGDDEFD DEAPEELTFA SAQAEAREEE RRVRETVRRD KTLLKEKRKR REELFIEQKK RKLLPDTILE KLTTASQTNI KKSPGKVKEV NLQKKNEDCE KGNDSKKVKV QKVQSVSQNK SYLAVRLKDQ DLRDSRQQAA QAFIHNSLYG PGTNRTTVNK FLSLANKRLP VKRAAVQFLN NAWGIQKKQN AKRFKRRWMV RKMKTKK. It is sometimes possible for the material contained within the vial of "NOL7, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.