Mouse anti-Human ATP6V0D1 Monoclonal Antibody | anti-ATP6V0D1 antibody

ATP6V0D1 (V-type Proton ATPase Subunit D 1, V-ATPase Subunit D 1, 32kD Accessory Protein, V-ATPase 40kD Accessory Protein, V-ATPase AC39 Subunit, p39, Vacuolar Proton Pump Subunit D 1, ATP6D, VPATPD) (Biotin)

Cat. Num. AAA6140737

• Gene Names: ATP6V0D1; P39; VATX; VMA6; ATP6D; ATP6DV; VPATPD
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: ATP6V0D1; Monoclonal Antibody; ATP6V0D1 (V-type Proton ATPase Subunit D 1; V-ATPase Subunit D 1; 32kD Accessory Protein; V-ATPase 40kD Accessory Protein; V-ATPase AC39 Subunit; p39; Vacuolar Proton Pump Subunit D 1; ATP6D; VPATPD) (Biotin); anti-ATP6V0D1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2G12
• Specificity: Recognizes human ATP6V0D1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 1636

• Applicable Applications for anti-ATP6V0D1 antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 0.5ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa238-309 from ATP6V0D1 (NP_004682) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: AKLFPHCGRLYPEGLAQLARADDYEQVKNVADYYPEYKLLFEGAGSNPGDKTLEDRFFEHEVKLNKLAFLN
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(ATP6V0D1 monoclonal antibody Western Blot analysis of ATP6V0D1 expression in HeLa)

Western Blot (WB)

(Western Blot analysis of ATP6V0D1 expression in transfected 293T cell line by ATP6V0D1 monoclonal antibody Lane 1: ATP6V0D1 transfected lysate (40.3kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to ATP6V0D1 on formalin-fixed paraffin-embedded human stomach. [antibody concentration 0.5ug/ml])

Testing Data

(Detection limit for recombinant GST tagged ATP6V0D1 is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-ATP6V0D1 antibody

Antibodies; Enzymes; ATPase

References

1. Proteomic analysis of endosomes from genetically modified p14/MP1 mouse embryonic fibroblasts. Stasyk T, Holzmann J, Stumberger S, Ebner HL, Hess MW, Bonn GK, Mechtler K, Huber LA.PROTEOMICS (2010) DOI: 10.1002/ pmic.201000258

NCBI and Uniprot Product Information

• NCBI GI #: 1519242633
• NCBI GeneID: 9114
• NCBI Accession #: NM_004691.5
• NCBI GenBank Nucleotide #: NM_004691
• UniProt Accession #: P61421
• NCBI Official Full Name: Homo sapiens ATPase H+ transporting V0 subunit d1 (ATP6V0D1), mRNA
• NCBI Official Synonym Full Names: ATPase H+ transporting V0 subunit d1
• NCBI Official Symbol: ATP6V0D1
• NCBI Official Synonym Symbols: P39; VATX; VMA6; ATP6D; ATP6DV; VPATPD
• NCBI Protein Information: V-type proton ATPase subunit d 1
• UniProt Protein Name: V-type proton ATPase subunit d 1
• Protein Family: V-type proton ATPase
• UniProt Gene Name: ATP6V0D1
• UniProt Synonym Gene Names: ATP6D; VPATPD; V-ATPase subunit d 1; p39
• UniProt Entry Name: VA0D1_HUMAN

NCBI Description

This gene encodes a component of vacuolar ATPase (V-ATPase), a multisubunit enzyme that mediates acidification of eukaryotic intracellular organelles. V-ATPase dependent organelle acidification is necessary for such intracellular processes as protein sorting, zymogen activation, receptor-mediated endocytosis, and synaptic vesicle proton gradient generation. V-ATPase is composed of a cytosolic V1 domain and a transmembrane V0 domain. The V1 domain consists of three A and three B subunits, two G subunits plus the C, D, E, F, and H subunits. The V1 domain contains the ATP catalytic site. The V0 domain consists of five different subunits: a, c, c', c'', and d. Additional isoforms of many of the V1 and V0 subunit proteins are encoded by multiple genes or alternatively spliced transcript variants. This encoded protein is known as the D subunit and is found ubiquitously. [provided by RefSeq, Jul 2008]

Uniprot Description

ATP6V0D1: Subunit of the integral membrane V0 complex of vacuolar ATPase. Vacuolar ATPase is responsible for acidifying a variety of intracellular compartments in eukaryotic cells, thus providing most of the energy required for transport processes in the vacuolar system. May play a role in coupling of proton transport and ATP hydrolysis. Belongs to the V-ATPase V0D/AC39 subunit family.

Protein type: Hydrolase; Vesicle; EC 3.6.3.14; Energy Metabolism - oxidative phosphorylation

Chromosomal Location of Human Ortholog: 16q22.1

Cellular Component: centrosome; phagocytic vesicle membrane; synaptic vesicle; membrane; lysosomal membrane; apical plasma membrane; early endosome; endosome membrane; vacuolar proton-transporting V-type ATPase complex; nerve terminal

Molecular Function: hydrogen-exporting ATPase activity, phosphorylative mechanism; protein binding; protein complex binding

Biological Process: interaction with host; proton transport; cellular protein metabolic process; unfolded protein response, activation of signaling protein activity; unfolded protein response; cellular iron ion homeostasis; ATP hydrolysis coupled proton transport; insulin receptor signaling pathway; transferrin transport; cilium biogenesis; brain development; transmembrane transport