Rabbit NNT Polyclonal Antibody | anti-NNT antibody

NNT antibody - N-terminal region

Cat. Num. AAA3208377

• Gene Names: NNT; GCCD4
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Applications: Western Blot
• Purity: Affinity Purified
• Synonyms: NNT; Polyclonal Antibody; NNT antibody - N-terminal region; anti-NNT antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: IVRGFDTRAAALEQFKSLGAEPLEVDLKESGEGQGGYAKEMSKEFIEAEM
• Sequence Length: 1086

• Applicable Applications for anti-NNT antibody: Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 93%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NNT
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: NNTSample Type: Hela Whole cellLane A: Primary AntibodyLane B: Primary Antibody + Blocking PeptidePrimary Antibody Concentration: 1ug/mlPeptide Concentration: 5ug/mlLysate Quantity: 25ug/lane/LaneGel Concentration: 0.12)

Western Blot (WB)

(WB Suggested Anti-NNT Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Liver)

Related Product Information for anti-NNT antibody

This is a rabbit polyclonal antibody against NNT. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NNT is an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. This gene encodes an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. Two alternatively spliced variants, encoding the same protein, have been found for this gene.

Product Categories/Family for anti-NNT antibody

Polyclonal; Membrane Protein; Drugs and Drug Metabolism

NCBI and Uniprot Product Information

• NCBI GI #: 122939155
• NCBI GeneID: 23530
• NCBI Accession #: NP_036475
• NCBI GenBank Nucleotide #: NM_012343
• UniProt Accession #: Q13423
• Molecular Weight: 114kDa
• NCBI Official Full Name: NAD(P) transhydrogenase, mitochondrial isoform 1
• NCBI Official Synonym Full Names: nicotinamide nucleotide transhydrogenase
• NCBI Official Symbol: NNT
• NCBI Official Synonym Symbols: GCCD4
• NCBI Protein Information: NAD(P) transhydrogenase, mitochondrial
• UniProt Protein Name: NAD(P) transhydrogenase, mitochondrial
• Protein Family: NAD(P) transhydrogenase
• UniProt Gene Name: NNT
• UniProt Entry Name: NNTM_HUMAN

NCBI Description

This gene encodes an integral protein of the inner mitochondrial membrane. The enzyme couples hydride transfer between NAD(H) and NADP(+) to proton translocation across the inner mitochondrial membrane. Under most physiological conditions, the enzyme uses energy from the mitochondrial proton gradient to produce high concentrations of NADPH. The resulting NADPH is used for biosynthesis and in free radical detoxification. [provided by RefSeq, Sep 2016]

Uniprot Description

NNT: The transhydrogenation between NADH and NADP is coupled to respiration and ATP hydrolysis and functions as a proton pump across the membrane. May play a role in reactive oxygen species (ROS) detoxification in the adrenal gland. Defects in NNT are the cause of glucocorticoid deficiency type 4 (GCCD4). A rare, potentially lethal, autosomal recessive disorder characterized by resistance to ACTH action on the adrenal cortex, adrenal insufficiency and an inability of the adrenal cortex to produce cortisol. It usually presents in the neonatal period or in early childhood with episodes of hypoglycemia and other symptoms related to cortisol deficiency, including failure to thrive, recurrent illnesses or infections, convulsions, and shock. In a small number of patients hypoglycemia can be sufficiently severe and persistent that it leads to serious long-term neurological damage or death. The diagnosis is readily confirmed with a low plasma cortisol measurement in the presence of an elevated ACTH level, and normal aldosterone and plasma renin measurements.

Protein type: Cofactor and Vitamin Metabolism - nicotinate and nicotinamide; Mitochondrial; EC 1.6.1.2; Membrane protein, integral; Oxidoreductase; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 5p12

Cellular Component: mitochondrion; membrane; mitochondrial inner membrane; integral to membrane; mitochondrial respiratory chain

Molecular Function: NAD(P) transhydrogenase activity; NAD(P)+ transhydrogenase (AB-specific) activity; NADP binding; NAD binding; NAD(P)+ transhydrogenase (B-specific) activity

Biological Process: cellular metabolic process; proton transport; cell redox homeostasis; tricarboxylic acid cycle

Disease: Glucocorticoid Deficiency 4