Rabbit anti-Human NMU Polyclonal Antibody | anti-NMU antibody

NMU (Neuromedin U, Neuromedin-U-25, NmU-25) (Biotin)

Cat. Num. AAA6387185

• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NMU; Polyclonal Antibody; NMU (Neuromedin U; Neuromedin-U-25; NmU-25) (Biotin); anti-NMU antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NMU.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-NMU antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NMU, aa1-174 (NP_006672.1).
• Immunogen Sequence: MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
• Conjugate: Biotin
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NMU expression in transfected 293T cell line by NMU polyclonal antibody. Lane 1: NMU transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-NMU antibody

Neuromedin U (NmU) is synthesized from a large precursor peptide and cleaved into 25aa (human NmU, 25aa; rat NmU, 23aa; porcine NmU, 25aa) and 8aa (Nmu-8; 18-25) biologically active peptides. NmU peptides from various species share the greatest homology in the their C-terminal regions, which is also critical in biological activity. NmU is present in nerves throughout the GI-tracts, corticotrophs within the anterior and lobe of rat and human pituitary glands, parafollicular cells of in rat thyroid gland, and in various regions of brain (spinal cord, hypothalamus, substantia nigra, hippocampus, amygdala). Low levels of NmU are also found in human adipose tissue, lymphocytes, and spleen.

Product Categories/Family for anti-NMU antibody

Antibodies; Peptides

NCBI and Uniprot Product Information

• NCBI GI #: 5729947
• NCBI GeneID: 10874
• NCBI Accession #: NP_006672.1
• NCBI GenBank Nucleotide #: NM_006681
• UniProt Accession #: P48645
• Molecular Weight: 19,741 Da
• NCBI Official Full Name: neuromedin-U
• NCBI Official Synonym Full Names: neuromedin U
• NCBI Official Symbol: NMU
• NCBI Protein Information: neuromedin-U; prepro-NMU
• UniProt Protein Name: Neuromedin-U
• Protein Family: Neuromedin
• UniProt Gene Name: NMU
• UniProt Synonym Gene Names: NmU-25
• UniProt Entry Name: NMU_HUMAN

NCBI Description

This gene encodes a member of the neuromedin family of neuropeptides. The encoded protein is a precursor that is proteolytically processed to generate a biologically active neuropeptide that plays a role in pain, stress, immune-mediated inflammatory diseases and feeding regulation. Increased expression of this gene was observed in renal, pancreatic and lung cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. Some of these isoforms may undergo similar processing to generate the mature peptide. [provided by RefSeq, Jul 2015]

Uniprot Description

NMU: Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder. Belongs to the NmU family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: extracellular region; terminal button

Molecular Function: neuromedin U receptor binding; receptor binding

Biological Process: regulation of smooth muscle contraction; gastric acid secretion; G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway; eating behavior; photoperiodism; digestion; positive regulation of hormone secretion; positive regulation of smooth muscle contraction; signal transduction; sensory perception of pain; positive regulation of synaptic transmission