Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

SDS-PAGE

Cyclin-dependent kinase 4 inhibitor D (CDKN2D) Recombinant Protein | CDKN2D recombinant protein

Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D)

Gene Names
CDKN2D; p19; INK4D; p19-INK4D
Purity
Greater or equal to 85% purity as determined by SDS-PAGE.
Synonyms
Cyclin-dependent kinase 4 inhibitor D (CDKN2D); Recombinant Human Cyclin-dependent kinase 4 inhibitor D (CDKN2D); Cyclin-dependent kinase 4 inhibitor D; p19-INK4d; CDKN2D recombinant protein
Ordering
For Research Use Only!
Host
E Coli or Yeast or Baculovirus or Mammalian Cell
Purity/Purification
Greater or equal to 85% purity as determined by SDS-PAGE.
Form/Format
Lyophilized or liquid (Format to be determined during the manufacturing process)
Sequence Positions
1-166aa; Full Length
Sequence
MLLEEVRAGDRLSGAAARGDVQEVRRLLHRELVHPDALNRFGKTALQVMMFGSTAIALELLKQGASPNVQDTSGTSPVHDAARTGFLDTLKVLVEHGADVNVPDGTGALPIHLAVQEGHTAVVSFLAAESDLHRRDARGLTPLELALQRGAQDLVDILQGHMVAPL
Sequence Length
166
Species
Homo sapiens (Human)
Preparation and Storage
Store at -20 degrees C. For long-term storage, store at -20 degrees C or -80 degrees C. Store working aliquots at 4 degrees C for up to one week. Repeated freezing and thawing is not recommended.

SDS-PAGE

SDS-PAGE
Related Product Information for CDKN2D recombinant protein
Interacts strongly with CDK4 and CDK6 and inhibits them
Product Categories/Family for CDKN2D recombinant protein

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
44.7 kDa
NCBI Official Full Name
cyclin-dependent kinase 4 inhibitor D
NCBI Official Synonym Full Names
cyclin-dependent kinase inhibitor 2D (p19, inhibits CDK4)
NCBI Official Symbol
CDKN2D
NCBI Official Synonym Symbols
p19; INK4D; p19-INK4D
NCBI Protein Information
cyclin-dependent kinase 4 inhibitor D; CDK inhibitor p19INK4d; inhibitor of cyclin-dependent kinase 4d; cyclin-dependent kinase 4 inhibitor D p19; cell cycle inhibitor, Nur77 associating protein
UniProt Protein Name
Cyclin-dependent kinase 4 inhibitor D
UniProt Gene Name
CDKN2D
UniProt Entry Name
CDN2D_HUMAN

NCBI Description

The protein encoded by this gene is a member of the INK4 family of cyclin-dependent kinase inhibitors. This protein has been shown to form a stable complex with CDK4 or CDK6, and prevent the activation of the CDK kinases, thus function as a cell growth regulator that controls cell cycle G1 progression. The abundance of the transcript of this gene was found to oscillate in a cell-cycle dependent manner with the lowest expression at mid G1 and a maximal expression during S phase. The negative regulation of the cell cycle involved in this protein was shown to participate in repressing neuronal proliferation, as well as spermatogenesis. Two alternatively spliced variants of this gene, which encode an identical protein, have been reported. [provided by RefSeq, Jul 2008]

Uniprot Description

CDKN2D: Interacts strongly with CDK4 and CDK6 and inhibits them. Belongs to the CDKN2 cyclin-dependent kinase inhibitor family.

Protein type: Tumor suppressor; Inhibitor; Cell cycle regulation

Chromosomal Location of Human Ortholog: 19p13

Cellular Component: cytoplasm; nucleus; cytosol

Molecular Function: cyclin-dependent protein kinase inhibitor activity; protein binding; protein kinase binding

Biological Process: response to retinoic acid; negative regulation of caspase activity; DNA synthesis during DNA repair; negative regulation of cell proliferation; response to vitamin D; sensory perception of sound; autophagic cell death; negative regulation of phosphorylation; mitotic cell cycle; negative regulation of cell growth; regulation of cyclin-dependent protein kinase activity; cell cycle arrest; G1/S transition of mitotic cell cycle; response to UV

Research Articles on CDKN2D

Similar Products

Product Notes

The CDKN2D cdkn2d (Catalog #AAA968592) is a Recombinant Protein produced from E Coli or Yeast or Baculovirus or Mammalian Cell and is intended for research purposes only. The product is available for immediate purchase. The immunogen sequence is 1-166aa; Full Length. The amino acid sequence is listed below: MLLEEVRAGD RLSGAAARGD VQEVRRLLHR ELVHPDALNR FGKTALQVMM FGSTAIALEL LKQGASPNVQ DTSGTSPVHD AARTGFLDTL KVLVEHGADV NVPDGTGALP IHLAVQEGHT AVVSFLAAES DLHRRDARGL TPLELALQRG AQDLVDILQG HMVAPL. It is sometimes possible for the material contained within the vial of "Cyclin-dependent kinase 4 inhibitor D (CDKN2D), Recombinant Protein" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.