Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NMU expression in transfected 293T cell line by NMU polyclonal antibody. Lane 1: NMU transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NMU Polyclonal Antibody | anti-NMU antibody

NMU (Neuromedin U, Neuromedin-U-25, NmU-25) APC

Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NMU; Polyclonal Antibody; NMU (Neuromedin U; Neuromedin-U-25; NmU-25) APC; anti-NMU antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NMU.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-NMU antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NMU, aa1-174 (NP_006672.1).
Immunogen Sequence
MLRTESCRPRSPAGQVAAASPLLLLLLLLAWCAGACRGAPILPQGLQPEQQLQLWNEIDDTCSSFLSIDSQPQASNALEELCFMIMGMLPKPQEQDEKDNTKRFLFHYSKTQKLGKSNVVSSVVHPLLQLVPHLHERRMKRFRVDEEFQSPFASQSRGYFLFRPRNGRRSAGFI
Conjugate
APC
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NMU expression in transfected 293T cell line by NMU polyclonal antibody. Lane 1: NMU transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NMU expression in transfected 293T cell line by NMU polyclonal antibody. Lane 1: NMU transfected lysate (19.7kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NMU antibody
Neuromedin U (NmU) is synthesized from a large precursor peptide and cleaved into 25aa (human NmU, 25aa; rat NmU, 23aa; porcine NmU, 25aa) and 8aa (Nmu-8; 18-25) biologically active peptides. NmU peptides from various species share the greatest homology in the their C-terminal regions, which is also critical in biological activity. NmU is present in nerves throughout the GI-tracts, corticotrophs within the anterior and lobe of rat and human pituitary glands, parafollicular cells of in rat thyroid gland, and in various regions of brain (spinal cord, hypothalamus, substantia nigra, hippocampus, amygdala). Low levels of NmU are also found in human adipose tissue, lymphocytes, and spleen.
Product Categories/Family for anti-NMU antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
19,741 Da
NCBI Official Full Name
neuromedin-U
NCBI Official Synonym Full Names
neuromedin U
NCBI Official Symbol
NMU
NCBI Protein Information
neuromedin-U; prepro-NMU
UniProt Protein Name
Neuromedin-U
Protein Family
UniProt Gene Name
NMU
UniProt Synonym Gene Names
NmU-25
UniProt Entry Name
NMU_HUMAN

NCBI Description

This gene encodes a member of the neuromedin family of neuropeptides. The encoded protein is a precursor that is proteolytically processed to generate a biologically active neuropeptide that plays a role in pain, stress, immune-mediated inflammatory diseases and feeding regulation. Increased expression of this gene was observed in renal, pancreatic and lung cancers. Alternative splicing results in multiple transcript variants encoding different isoforms. Some of these isoforms may undergo similar processing to generate the mature peptide. [provided by RefSeq, Jul 2015]

Uniprot Description

NMU: Stimulates muscle contractions of specific regions of the gastrointestinal tract. In humans, NmU stimulates contractions of the ileum and urinary bladder. Belongs to the NmU family.

Protein type: Secreted; Secreted, signal peptide

Chromosomal Location of Human Ortholog: 4q12

Cellular Component: extracellular region; terminal button

Molecular Function: neuromedin U receptor binding; receptor binding

Biological Process: regulation of smooth muscle contraction; gastric acid secretion; G-protein coupled receptor protein signaling pathway; neuropeptide signaling pathway; eating behavior; photoperiodism; digestion; positive regulation of hormone secretion; positive regulation of smooth muscle contraction; signal transduction; sensory perception of pain; positive regulation of synaptic transmission

Research Articles on NMU

Similar Products

Product Notes

The NMU nmu (Catalog #AAA6387184) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NMU (Neuromedin U, Neuromedin-U-25, NmU-25) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NMU can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NMU nmu for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NMU, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.