Western Blot (WB)
(Host: RabbitTarget Name: NKX61Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Rabbit NKX6-1 Polyclonal Antibody | anti-NKX6-1 antibody
NKX6-1 Antibody - N-terminal region
Gene Names
NKX6-1; NKX6A; NKX6.1
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity purified
Synonyms
NKX6-1; Polyclonal Antibody; NKX6-1 Antibody - N-terminal region; anti-NKX6-1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PSPPLGTHNPGGLKPPATGGLSSLGSPPQQLSAATPHGINDILSRPSMPV
Sequence Length
367
Applicable Applications for anti-NKX6-1 antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N-terminal region of Human NKX61
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NKX61Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NKX61Sample Type: Fetal Lung lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-NKX6-1 antibody
This is a rabbit polyclonal antibody against NKX61. It was validated on Western Blot
Target Description: In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM, Mar 2008]
Target Description: In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM, Mar 2008]
Product Categories/Family for anti-NKX6-1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Synonym Full Names
NK6 homeobox 1
NCBI Official Symbol
NKX6-1
NCBI Official Synonym Symbols
NKX6A; NKX6.1
NCBI Protein Information
homeobox protein Nkx-6.1
UniProt Protein Name
Homeobox protein Nkx-6.1
Protein Family
UniProt Gene Name
NKX6-1
UniProt Synonym Gene Names
NKX6A
NCBI Description
In the pancreas, NKX6.1 is required for the development of beta cells and is a potent bifunctional transcription regulator that binds to AT-rich sequences within the promoter region of target genes Iype et al. (2004) [PubMed 15056733].[supplied by OMIM, Mar 2008]
Uniprot Description
Transcription factor which binds to specific A/T-rich DNA sequences in the promoter regions of a number of genes. Involved in transcriptional regulation in islet beta cells. Binds to the insulin promoter and is involved in regulation of the insulin gene. Together with NKX2-2 and IRX3 acts to restrict the generation of motor neurons to the appropriate region of the neural tube. Belongs to the class II proteins of neuronal progenitor factors, which are induced by SHH signals ().
Research Articles on NKX6-1
Similar Products
Product Notes
The NKX6-1 nkx6-1 (Catalog #AAA3200728) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NKX6-1 Antibody - N-terminal region reacts with Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NKX6-1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NKX6-1 nkx6-1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PSPPLGTHNP GGLKPPATGG LSSLGSPPQQ LSAATPHGIN DILSRPSMPV. It is sometimes possible for the material contained within the vial of "NKX6-1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
