Western Blot (WB)
(Host: RabbitTarget Name: NEXNSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Rabbit NEXN Polyclonal Antibody | anti-NEXN antibody
NEXN antibody - middle region
Gene Names
NEXN; CMH20; NELIN
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NEXN; Polyclonal Antibody; NEXN antibody - middle region; anti-NEXN antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMVNEDEENQDTAKI
Sequence Length
675
Applicable Applications for anti-NEXN antibody
Western Blot (WB)
Homology
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NEXN
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: NEXNSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: NEXNSample Tissue: Human Fetal LungAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-NEXN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Western Blot (WB)
(WB Suggested Anti-NEXN Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Human Liver)
Related Product Information for anti-NEXN antibody
This is a rabbit polyclonal antibody against NEXN. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: NEXN is involved in regulating cell migration through association with the actin cytoskeleton.
Target Description: NEXN is involved in regulating cell migration through association with the actin cytoskeleton.
Product Categories/Family for anti-NEXN antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
81kDa
NCBI Official Full Name
nexilin isoform 1
NCBI Official Synonym Full Names
nexilin F-actin binding protein
NCBI Official Symbol
NEXN
NCBI Official Synonym Symbols
CMH20; NELIN
NCBI Protein Information
nexilin
UniProt Protein Name
Nexilin
Protein Family
UniProt Gene Name
NEXN
NCBI Description
This gene encodes a filamentous actin-binding protein that may function in cell adhesion and migration. Mutations in this gene have been associated with dilated cardiomyopathy, also known as CMD1CC. Alternatively spliced transcript variants have been described.[provided by RefSeq, Feb 2010]
Uniprot Description
Involved in regulating cell migration through association with the actin cytoskeleton. Has an essential role in the maintenance of Z line and sarcomere integrity.
Research Articles on NEXN
Similar Products
Product Notes
The NEXN nexn (Catalog #AAA3208826) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEXN antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEXN can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NEXN nexn for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EELERQRQEN RKKQAEEEAR KRLEEEKRAF EEARRQMVNE DEENQDTAKI. It is sometimes possible for the material contained within the vial of "NEXN, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
