Western Blot (WB)
(Host: RabbitTarget Name: SPICE1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Rabbit CCDC52 Polyclonal Antibody | anti-SPICE1 antibody
CCDC52 antibody - middle region
Gene Names
SPICE1; SPICE; CCDC52
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
CCDC52; Polyclonal Antibody; CCDC52 antibody - middle region; anti-SPICE1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KEQNWEEKTLPIDTDIQNSSEENRLFTQRWRVSHMGEDLENKTQAPFVNL
Sequence Length
855
Applicable Applications for anti-SPICE1 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 79%; Guinea Pig: 93%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human CCDC52
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(Host: RabbitTarget Name: SPICE1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SPICE1Sample Type: Human Adult PlacentaAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SPICE1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(Host: RabbitTarget Name: SPICE1Sample Type: Human Fetal MuscleAntibody Dilution: 1.0ug/ml)
Western Blot (WB)
(WB Suggested Anti-CCDC52 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Western Blot (WB)
(WB Suggested Anti-CCDC52 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: Transfected 293T)
Related Product Information for anti-SPICE1 antibody
This is a rabbit polyclonal antibody against CCDC52. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: The specific function of CCDC52 is not yet known.
Target Description: The specific function of CCDC52 is not yet known.
Product Categories/Family for anti-SPICE1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
96kDa
NCBI Official Full Name
spindle and centriole-associated protein 1 isoform a
NCBI Official Synonym Full Names
spindle and centriole associated protein 1
NCBI Official Symbol
SPICE1
NCBI Official Synonym Symbols
SPICE; CCDC52
NCBI Protein Information
spindle and centriole-associated protein 1
UniProt Protein Name
Spindle and centriole-associated protein 1
Protein Family
UniProt Gene Name
SPICE1
UniProt Synonym Gene Names
CCDC52; SPICE
UniProt Entry Name
SPICE_HUMAN
Research Articles on SPICE1
Similar Products
Product Notes
The SPICE1 spice1 (Catalog #AAA3210960) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The CCDC52 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's CCDC52 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SPICE1 spice1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KEQNWEEKTL PIDTDIQNSS EENRLFTQRW RVSHMGEDLE NKTQAPFVNL. It is sometimes possible for the material contained within the vial of "CCDC52, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
