Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human kidney )

Rabbit NEDD9 Polyclonal Antibody | anti-NEDD9 antibody

NEDD9 antibody - middle region

Gene Names
NEDD9; CAS2; CASL; HEF1; CAS-L; CASS2
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
NEDD9; Polyclonal Antibody; NEDD9 antibody - middle region; anti-NEDD9 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HPPPQLGQSVGSQNDAYDVPRGVQFLEPPAETSEKANPQERDGVYDVPLH
Sequence Length
834
Applicable Applications for anti-NEDD9 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 86%; Dog: 93%; Guinea Pig: 79%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 79%; Rat: 79%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human NEDD9
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human kidney )

Immunohistochemistry (IHC) (Human kidney )

Western Blot (WB)

(WB Suggested Anti-NEDD9 Antibody Titration: 5.0ug/mlPositive Control: 721_B cell lysateNEDD9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)

Western Blot (WB) (WB Suggested Anti-NEDD9 Antibody Titration: 5.0ug/mlPositive Control: 721_B cell lysateNEDD9 is strongly supported by BioGPS gene expression data to be expressed in Human 721_B cells)
Related Product Information for anti-NEDD9 antibody
This is a rabbit polyclonal antibody against NEDD9. It was validated on Western Blot and immunohistochemistry

Target Description: Variation in NEDD9 is associated wih susceptibility to late-onset Alzheimer and Parkinson diseases. Changes in expression of the scaffold protein HEF1/CAS-L/NEDD9 were found to be a potent prometastatic stimulus in melanoma and other cancers.
Product Categories/Family for anti-NEDD9 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
93kDa
NCBI Official Full Name
enhancer of filamentation 1 isoform 1
NCBI Official Synonym Full Names
neural precursor cell expressed, developmentally down-regulated 9
NCBI Official Symbol
NEDD9
NCBI Official Synonym Symbols
CAS2; CASL; HEF1; CAS-L; CASS2
NCBI Protein Information
enhancer of filamentation 1
UniProt Protein Name
Enhancer of filamentation 1
Protein Family
UniProt Gene Name
NEDD9
UniProt Synonym Gene Names
CASL; CASS2; hEF1; CAS-L; CasL; NEDD-9
UniProt Entry Name
CASL_HUMAN

NCBI Description

The protein encoded by this gene is a member of the CRK-associated substrates family. Members of this family are adhesion docking molecules that mediate protein-protein interactions for signal transduction pathways. This protein is a focal adhesion protein that acts as a scaffold to regulate signaling complexes important in cell attachment, migration and invasion as well as apoptosis and the cell cycle. This protein has also been reported to have a role in cancer metastasis. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012]

Uniprot Description

Cas-L: a widely expressed docking protein which plays a central coordinating role for tyrosine-kinase-based signaling in cell adhesion. May function in transmitting growth control signals between focal adhesions at the cell periphery and the mitotic spindle in response to adhesion or growth factor signals initiating cell proliferation. Integrin beta-1 stimulation leads to recruitment of various proteins including CRK, NCK and SHPTP2 to the tyrosine phosphorylated form. Phosphorylated following integrin beta-1, antigen receptor, or C1a calcitonin receptor signaling. Transformation of fibroblasts with v-ABL results in an increase in its tyrosine phosphorylation. Phosphorylated by focal adhesion kinase. Highly expressed in kidney, lung, and placenta. Also detected in T-cells, B-cells and diverse cell lines.

Protein type: Motility/polarity/chemotaxis; Adaptor/scaffold

Chromosomal Location of Human Ortholog: 6p24.2

Cellular Component: spindle pole; Golgi apparatus; focal adhesion; lamellipodium; cytoplasm; spindle; cell cortex; nucleus

Molecular Function: protein binding

Biological Process: integrin-mediated signaling pathway; mitosis; actin filament bundle formation; cell division; regulation of growth; cytoskeleton organization and biogenesis; signal transduction; cell adhesion

Research Articles on NEDD9

Similar Products

Product Notes

The NEDD9 nedd9 (Catalog #AAA3210248) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NEDD9 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NEDD9 can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the NEDD9 nedd9 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HPPPQLGQSV GSQNDAYDVP RGVQFLEPPA ETSEKANPQE RDGVYDVPLH. It is sometimes possible for the material contained within the vial of "NEDD9, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.