Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Mouse anti-Human, Rat PGGT1B Monoclonal Antibody | anti-PGGT1B antibody

PGGT1B (Geranylgeranyl Transferase Type-1 Subunit beta, Geranylgeranyl Transferase Type I Subunit beta, GGTase-I-beta, Type I Protein Geranyl-Geranyltransferase Subunit beta) (PE)

Reactivity
Human, Rat
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
PGGT1B; Monoclonal Antibody; PGGT1B (Geranylgeranyl Transferase Type-1 Subunit beta; Geranylgeranyl Transferase Type I Subunit beta; GGTase-I-beta; Type I Protein Geranyl-Geranyltransferase Subunit beta) (PE); anti-PGGT1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Rat
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5E4
Specificity
Recognizes human PGGT1B. Species Crossreactivity: rat.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
377
Applicable Applications for anti-PGGT1B antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-106 from human PGGT1B (NP_005014) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MVATEDERLAGSGEGERLDFLRDRHVRFFQRCLQVLPERYSSLETSRLTIAFFALSGLDMLDSLDVVNKDDIIEWIYSLQVLPTEDRSNLNRCGFRGSSYLGIPF
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.29kD).)

Western Blot (WB)

(PGGT1B monoclonal antibody Western Blot analysis of PGGT1B expression in HeLa.)

Western Blot (WB) (PGGT1B monoclonal antibody Western Blot analysis of PGGT1B expression in HeLa.)

Western Blot (WB)

(PGGT1B monoclonal antibody Western Blot analysis of PGGT1B expression in PC-12.)

Western Blot (WB) (PGGT1B monoclonal antibody Western Blot analysis of PGGT1B expression in PC-12.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to PGGT1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to PGGT1B on formalin-fixed paraffin-embedded human kidney. [antibody concentration 1.2ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to PGGT1B on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to PGGT1B on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged PGGT1B is ~1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged PGGT1B is ~1ng/ml as a capture antibody.)
Product Categories/Family for anti-PGGT1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
geranylgeranyl transferase type-1 subunit beta
UniProt Protein Name
Geranylgeranyl transferase type-1 subunit beta
UniProt Gene Name
PGGT1B
UniProt Entry Name
PGTB1_HUMAN

Similar Products

Product Notes

The PGGT1B pggt1b (Catalog #AAA6159412) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The PGGT1B (Geranylgeranyl Transferase Type-1 Subunit beta, Geranylgeranyl Transferase Type I Subunit beta, GGTase-I-beta, Type I Protein Geranyl-Geranyltransferase Subunit beta) (PE) reacts with Human, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's PGGT1B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the PGGT1B pggt1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "PGGT1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.