Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NDUFA5 Polyclonal Antibody | anti-NDUFA5 antibody

NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5, Complex I Subunit B13, Complex I-13kD-B, CI-13kD-B, NADH-ubiquinone Oxidoreductase 13 kDa-B Subunit, DKFZp781K1356, FLJ12147)

Gene Names
NDUFA5; B13; NUFM; UQOR13; CI-13kB; CI-13KD-B
Reactivity
Human
Applications
Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
NDUFA5; Polyclonal Antibody; NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5; Complex I Subunit B13; Complex I-13kD-B; CI-13kD-B; NADH-ubiquinone Oxidoreductase 13 kDa-B Subunit; DKFZp781K1356; FLJ12147); Anti -NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5; anti-NDUFA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFA5.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Applicable Applications for anti-NDUFA5 antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human NDUFA5, aa1-116 (NP_004991.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NDUFA5 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,459 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5
NCBI Official Symbol
NDUFA5
NCBI Official Synonym Symbols
B13; NUFM; UQOR13; CI-13kB; CI-13KD-B
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5; Complex I-13KD-B; type I dehydrogenase; ubiquinone reductase; complex I subunit B13; complex I 13kDa subunit B; NADH-ubiquinone oxidoreductase 13 kDa-B subunit; NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 5, 13kDa
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Protein Family
UniProt Gene Name
NDUFA5
UniProt Synonym Gene Names
CI-13kD-B
UniProt Entry Name
NDUA5_HUMAN

NCBI Description

The human NDUFA5 gene codes for the B13 subunit of complex I of the respiratory chain, which transfers electrons from NADH to ubiquinone. The high degree of conservation of NDUFA5 extending to plants and fungi indicates its functional significance in the enzyme complex. The protein localizes to the inner mitochondrial membrane as part of the 7 component-containing, water soluble "iron-sulfur protein" (IP) fraction of complex I, although its specific role is unknown. It is assumed to undergo post-translational removal of the initiator methionine and N-acetylation of the next amino acid. The predicted secondary structure is primarily alpha helix, but the carboxy-terminal half of the protein has high potential to adopt a coiled-coil form. The amino-terminal part contains a putative beta sheet rich in hydrophobic amino acids that may serve as mitochondrial import signal. Several transcript variants encoding different isoforms have been found for this gene. Related pseudogenes have also been identified on four other chromosomes. [provided by RefSeq, Sep 2013]

Uniprot Description

Function: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.

Subunit structure: Complex I is composed of 45 different subunits. Ref.9

Subcellular location: Mitochondrion inner membrane; Peripheral membrane protein; Matrix side.

Tissue specificity: Expressed in all tissues examined with highest levels in heart, skeletal muscle and brain.

Sequence similarities: Belongs to the complex I NDUFA5 subunit family.

Research Articles on NDUFA5

Similar Products

Product Notes

The NDUFA5 ndufa5 (Catalog #AAA646222) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5, Complex I Subunit B13, Complex I-13kD-B, CI-13kD-B, NADH-ubiquinone Oxidoreductase 13 kDa-B Subunit, DKFZp781K1356, FLJ12147) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the NDUFA5 ndufa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAGVLKKTTG LVGLAVCNTP HERLRILYTK ILDVLEEIPK NAAYRKYTEQ ITNEKLAMVK AEPDVKKLED QLQGGQLEEV ILQAEHELNL ARKMREWKLW EPLVEEPPAD QWKWPI. It is sometimes possible for the material contained within the vial of "NDUFA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.