Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Human Liver )

Rabbit SCD Polyclonal Antibody | anti-SCD antibody

SCD antibody - middle region

Gene Names
SCD; SCD1; FADS5; SCDOS; hSCD1; MSTP008
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Sheep
Applications
Immunohistochemistry, Western Blot
Purity
Protein A purified
Synonyms
SCD; Polyclonal Antibody; SCD antibody - middle region; anti-SCD antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Goat, Guinea Pig, Human, Sheep
Clonality
Polyclonal
Purity/Purification
Protein A purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: HPAVKEKGSTLDLSDLEAEKLVMFQRRYYKPGLLMMCFILPTLVPWYFWG
Sequence Length
359
Applicable Applications for anti-SCD antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 92%; Dog: 85%; Goat: 85%; Guinea Pig: 85%; Human: 100%; Mouse: 77%; Rat: 77%; Sheep: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SCD
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Human Liver )

Immunohistochemistry (IHC) (Human Liver )

Western Blot (WB)

(Host: RabbitTarget Name: SCDSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SCDSample Tissue: Human JurkatAntibody Dilution: 1.0ug/ml)

Western Blot (WB)

(WB Suggested Anti-SCD Antibody Titration: 1.0ug/mlPositive Control: Human Liver)

Western Blot (WB) (WB Suggested Anti-SCD Antibody Titration: 1.0ug/mlPositive Control: Human Liver)
Related Product Information for anti-SCD antibody
This is a rabbit polyclonal antibody against SCD. It was validated on Western Blot and immunohistochemistry

Target Description: Stearoyl-CoA desaturase ( fatty acid desaturase, SCD) is expressed at high levels in several human tissues and is required for the biosynthesis of oleate (18:1) and palmitoleate (16:1). These monounsaturated fatty acids are the major components of phospholipids, triglycerides, wax esters, and cholesterol esters.
Product Categories/Family for anti-SCD antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
41kDa
NCBI Official Full Name
acyl-CoA desaturase
NCBI Official Synonym Full Names
stearoyl-CoA desaturase
NCBI Official Symbol
SCD
NCBI Official Synonym Symbols
SCD1; FADS5; SCDOS; hSCD1; MSTP008
NCBI Protein Information
acyl-CoA desaturase
UniProt Protein Name
Acyl-CoA desaturase
Protein Family
UniProt Gene Name
SCD
UniProt Synonym Gene Names
Delta-9 desaturase
UniProt Entry Name
ACOD_HUMAN

NCBI Description

This gene encodes an enzyme involved in fatty acid biosynthesis, primarily the synthesis of oleic acid. The protein belongs to the fatty acid desaturase family and is an integral membrane protein located in the endoplasmic reticulum. Transcripts of approximately 3.9 and 5.2 kb, differing only by alternative polyadenlyation signals, have been detected. A gene encoding a similar enzyme is located on chromosome 4 and a pseudogene of this gene is located on chromosome 17. [provided by RefSeq, Sep 2015]

Uniprot Description

SCD: Terminal component of the liver microsomal stearyl-CoA desaturase system, that utilizes O(2) and electrons from reduced cytochrome b5 to catalyze the insertion of a double bond into a spectrum of fatty acyl-CoA substrates including palmitoyl-CoA and stearoyl-CoA. Belongs to the fatty acid desaturase family.

Protein type: Lipid Metabolism - unsaturated fatty acid biosynthesis; Membrane protein, multi-pass; Endoplasmic reticulum; Oxidoreductase; Membrane protein, integral; EC 1.14.19.1

Chromosomal Location of Human Ortholog: 10q24.31

Cellular Component: endoplasmic reticulum membrane; membrane; endoplasmic reticulum; integral to membrane

Molecular Function: iron ion binding; stearoyl-CoA 9-desaturase activity

Biological Process: fatty acid biosynthetic process

Research Articles on SCD

Similar Products

Product Notes

The SCD scd (Catalog #AAA3201173) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SCD antibody - middle region reacts with Cow, Dog, Goat, Guinea Pig, Human, Sheep and may cross-react with other species as described in the data sheet. AAA Biotech's SCD can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the SCD scd for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: HPAVKEKGST LDLSDLEAEK LVMFQRRYYK PGLLMMCFIL PTLVPWYFWG. It is sometimes possible for the material contained within the vial of "SCD, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.