Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NDUFA5 Polyclonal Antibody | anti-NDUFA5 antibody

NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5, Complex I Subunit B13, Complex I-13kD-B, CI-13kD-B, NADH-ubiquinone Oxidoreductase 13kD-B Subunit, DKFZp781K1356, FLJ12147) (AP)

Gene Names
NDUFA5; B13; NUFM; UQOR13; CI-13kB; CI-13KD-B
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
NDUFA5; Polyclonal Antibody; NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5; Complex I Subunit B13; Complex I-13kD-B; CI-13kD-B; NADH-ubiquinone Oxidoreductase 13kD-B Subunit; DKFZp781K1356; FLJ12147) (AP); anti-NDUFA5 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFA5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-NDUFA5 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Full length human NDUFA5, aa1-116 (NP_004991.1).
Immunogen Sequence
MAGVLKKTTGLVGLAVCNTPHERLRILYTKILDVLEEIPKNAAYRKYTEQITNEKLAMVKAEPDVKKLEDQLQGGQLEEVILQAEHELNLARKMREWKLWEPLVEEPPADQWKWPI
Conjugate
AP
Note
Preservative Free
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFA5 expression in transfected 293T cell line by NDUFA5 polyclonal antibody. Lane 1: NDUFA5 transfected lysate (13.5kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-NDUFA5 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone.
Product Categories/Family for anti-NDUFA5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH:ubiquinone oxidoreductase subunit A5
NCBI Official Symbol
NDUFA5
NCBI Official Synonym Symbols
B13; NUFM; UQOR13; CI-13kB; CI-13KD-B
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5
Protein Family
UniProt Gene Name
NDUFA5
UniProt Synonym Gene Names
CI-13kD-B
UniProt Entry Name
NDUA5_HUMAN

NCBI Description

This nuclear gene encodes a conserved protein that comprises the B13 subunit of complex I of the mitochondrial respiratory chain. The encoded protein localizes to the inner mitochondrial membrane, where it is thought to aid in the transfer of electrons from NADH to ubiquinone. Alternative splicing results in multiple transcript variants. There are numerous pseudogenes of this gene on chromosomes 1, 3, 6, 8, 9, 11, 12, and 16. [provided by RefSeq, Apr 2014]

Uniprot Description

NDUFA5: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Belongs to the complex I NDUFA5 subunit family.

Protein type: EC 1.6.5.3; Mitochondrial; Energy Metabolism - oxidative phosphorylation; Oxidoreductase; EC 1.6.99.3

Chromosomal Location of Human Ortholog: 7q31.33

Cellular Component: mitochondrial inner membrane; mitochondrial respiratory chain complex I

Molecular Function: NADH dehydrogenase (ubiquinone) activity

Biological Process: cellular metabolic process; mitochondrial electron transport, NADH to ubiquinone

Research Articles on NDUFA5

Similar Products

Product Notes

The NDUFA5 ndufa5 (Catalog #AAA6386633) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA5 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 5, Complex I Subunit B13, Complex I-13kD-B, CI-13kD-B, NADH-ubiquinone Oxidoreductase 13kD-B Subunit, DKFZp781K1356, FLJ12147) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA5 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the NDUFA5 ndufa5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "NDUFA5, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.