Rabbit anti-Human NDUFA13 Polyclonal Antibody | anti-NDUFA13 antibody

NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13, Cell Death Regulatory Protein GRIM-19, Complex I-B16.6, CI-B16.6, Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein, GRIM-19, Gene Associated with Retinoic and

Cat. Num. AAA6386629

• Gene Names: NDUFA13; B16.6; CDA016; CGI-39; GRIM19; GRIM-19
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: NDUFA13; Polyclonal Antibody; NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13; Cell Death Regulatory Protein GRIM-19; Complex I-B16.6; CI-B16.6; Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein; GRIM-19; Gene Associated with Retinoic and; anti-NDUFA13 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NDUFA13.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.

• Applicable Applications for anti-NDUFA13 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human NDUFA13, aa1-144 (AAH09189.1).
• Immunogen Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
• Conjugate: MaxLight550
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Related Product Information for anti-NDUFA13 antibody

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.

Product Categories/Family for anti-NDUFA13 antibody

Antibodies; Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 39645234
• NCBI GeneID: 51079
• Molecular Weight: 24,882 Da
• NCBI Official Full Name: Homo sapiens NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13, mRNA
• NCBI Official Synonym Full Names: NADH:ubiquinone oxidoreductase subunit A13
• NCBI Official Symbol: NDUFA13
• NCBI Official Synonym Symbols: B16.6; CDA016; CGI-39; GRIM19; GRIM-19
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
• Protein Family: NADH dehydrogenase

NCBI Description

This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. [provided by RefSeq, Oct 2009]