Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of NDUFA13 expression in transfected 293T cell line by NDUFA13 polyclonal antibody. Lane 1: NDUFA13 transfected lysate (16.7kD). Lane 2: Non-transfected lysate.)

Rabbit anti-Human NDUFA13 Polyclonal Antibody | anti-NDUFA13 antibody

NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13, Cell Death Regulatory Protein GRIM-19, Complex I-B16.6, CI-B16.6, Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein, GRIM-19, Gene Associated with Retinoic and

Gene Names
NDUFA13; B16.6; CDA016; CGI-39; GRIM19; GRIM-19
Reactivity
Human
Applications
Western Blot, Immunoprecipitation
Purity
Serum
Serum
Synonyms
NDUFA13; Polyclonal Antibody; NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13; Cell Death Regulatory Protein GRIM-19; Complex I-B16.6; CI-B16.6; Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein; GRIM-19; Gene Associated with Retinoic and; Anti -NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13; anti-NDUFA13 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human NDUFA13.
Purity/Purification
Serum
Serum
Form/Format
Supplied as a liquid.
Sequence
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT
Applicable Applications for anti-NDUFA13 antibody
Western Blot (WB), Immunoprecipitation (IP)
Application Notes
Suitable for use in Western Blot and Immunoprecipitation.
Immunogen
Full length human NDUFA13, aa1-144 (AAH09189.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of NDUFA13 expression in transfected 293T cell line by NDUFA13 polyclonal antibody. Lane 1: NDUFA13 transfected lysate (16.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of NDUFA13 expression in transfected 293T cell line by NDUFA13 polyclonal antibody. Lane 1: NDUFA13 transfected lysate (16.7kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of NDUFA13 transfected lysate using NDUFA13 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NDUFA13 mouse polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of NDUFA13 transfected lysate using NDUFA13 rabbit polyclonal antibody and Protein A Magnetic Bead and immunoblotted with NDUFA13 mouse polyclonal antibody.)
Related Product Information for anti-NDUFA13 antibody
Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.
Product Categories/Family for anti-NDUFA13 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16,698 Da
NCBI Official Full Name
NADH dehydrogenase
NCBI Official Synonym Full Names
NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
NCBI Official Symbol
NDUFA13
NCBI Official Synonym Symbols
B16.6; CDA016; CGI-39; GRIM19; GRIM-19
NCBI Protein Information
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; CI-B16.6; complex I-B16.6; complex I B16.6 subunit; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein
UniProt Protein Name
NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
Protein Family
UniProt Gene Name
NDUFA13
UniProt Synonym Gene Names
GRIM19; CI-B16.6; GRIM-19
UniProt Entry Name
NDUAD_HUMAN

NCBI Description

This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. [provided by RefSeq, Oct 2009]

Uniprot Description

GRIM-19: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes. Defects in NDUFA13 may be a cause of susceptibility to Hurthle cell thyroid carcinoma (HCTC). Hurthle cell thyroid carcinoma accounts for approximately 3% of all thyroid cancers. Although they are classified as variants of follicular neoplasms, they are more often multifocal and somewhat more aggressive and are less likely to take up iodine than are other follicular neoplasms. Belongs to the complex I NDUFA13 subunit family.

Protein type: Mitochondrial; Oxidoreductase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; mitochondrion; mitochondrial membrane; mitochondrial inner membrane; cytoplasm; integral to membrane; mitochondrial respiratory chain complex I; mitochondrial respiratory chain

Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity; NADH dehydrogenase activity; ATP binding

Biological Process: cellular metabolic process; positive regulation of protein catabolic process; positive regulation of caspase activity; negative regulation of cell growth; negative regulation of transcription, DNA-dependent; protein import into mitochondrial inner membrane

Disease: Thyroid Carcinoma, Hurthle Cell

Research Articles on NDUFA13

Similar Products

Product Notes

The NDUFA13 ndufa13 (Catalog #AAA6011840) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13, Cell Death Regulatory Protein GRIM-19, Complex I-B16.6, CI-B16.6, Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein, GRIM-19, Gene Associated with Retinoic and reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's NDUFA13 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB), Immunoprecipitation (IP). Suitable for use in Western Blot and Immunoprecipitation. Researchers should empirically determine the suitability of the NDUFA13 ndufa13 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MAASKVKQDM PPPGGYGPID YKRNLPRRGL SGYSMLAIGI GTLIYGHWSI MKWNRERRRL QIEDFEARIA LLPLLQAETD RRTLQMLREN LEEEAIIMKD VPDWKVGESV FHTTRWVPPL IGELYGLRTT EEALHASHGF MWYT. It is sometimes possible for the material contained within the vial of "NDUFA13, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.