Mouse anti-Human NDUFA13 Polyclonal Antibody | anti-NDUFA13 antibody

NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13, Cell Death Regulatory Protein GRIM-19, Complex I-B16.6, CI-B16.6, Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein, GRIM-19, Gene Associated with Retinoic and

Cat. Num. AAA6011521

• Gene Names: NDUFA13; B16.6; CDA016; CGI-39; GRIM19; GRIM-19
• Reactivity: Human
• Applications: Western Blot, Immunohistochemistry, Immunofluorescence
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: NDUFA13; Polyclonal Antibody; NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13; Cell Death Regulatory Protein GRIM-19; Complex I-B16.6; CI-B16.6; Gene Associated with Retinoic and Interferon-induced Mortality 19 Protein; GRIM-19; Gene Associated with Retinoic and; Anti -NDUFA13 (NADH Dehydrogenase [Ubiquinone] 1 alpha Subcomplex Subunit 13; anti-NDUFA13 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human NDUFA13.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMLAIGIGTLIYGHWSIMKWNRERRRLQIEDFEARIALLPLLQAETDRRTLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVPPLIGELYGLRTTEEALHASHGFMWYT

• Applicable Applications for anti-NDUFA13 antibody: Western Blot (WB), Immunohistochemistry (IHC), Immunofluorescence (IF)
• Application Notes: Suitable for use in Immunofluorescence, Western Blot and Immunohistochemistry.; Dilution: Immunofluorescence: 10ug/ml; Immunohistochemistry (Formalin fixed paraffin embedded): 3ug/ml
• Immunogen: Full length human NDUFA13, aa1-144 (AAH09189.1).
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(NDUFA13 polyclonal antibody. Western Blot analysis of NDUFA13 expression in human liver.)

Western Blot (WB)

(Western Blot analysis of NDUFA13 expression in transfected 293T cell line by NDUFA13 polyclonal antibody. Lane 1: NDUFA13 transfected lysate (15.84kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of purified antibody to NDUFA13 on formalin-fixed paraffin-embedded human pancreas. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of purified antibody to NDUFA13 on HeLa cell. [antibody concentration 10ug/ml].)

Related Product Information for anti-NDUFA13 antibody

Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes.

Product Categories/Family for anti-NDUFA13 antibody

Antibodies; Abs to Enzymes; Dehydrogenase

NCBI and Uniprot Product Information

• NCBI GI #: 260763955
• NCBI GeneID: 51079
• NCBI Accession #: NP_057049.5
• NCBI GenBank Nucleotide #: NM_015965.6
• UniProt Accession #: Q9P0J0; Q6PKI0; Q9H2L3; Q9Y327
• Molecular Weight: 16,698 Da
• NCBI Official Full Name: NADH dehydrogenase
• NCBI Official Synonym Full Names: NADH dehydrogenase (ubiquinone) 1 alpha subcomplex, 13
• NCBI Official Symbol: NDUFA13
• NCBI Official Synonym Symbols: B16.6; CDA016; CGI-39; GRIM19; GRIM-19
• NCBI Protein Information: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13; CI-B16.6; complex I-B16.6; complex I B16.6 subunit; cell death-regulatory protein GRIM19; cell death regulatory protein GRIM-19; NADH-ubiquinone oxidoreductase B16.6 subunit; gene associated with retinoic and IFN-induced mortality 19 protein; gene associated with retinoic and interferon-induced mortality 19 protein
• UniProt Protein Name: NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
• Protein Family: NADH dehydrogenase
• UniProt Gene Name: NDUFA13
• UniProt Synonym Gene Names: GRIM19; CI-B16.6; GRIM-19
• UniProt Entry Name: NDUAD_HUMAN

NCBI Description

This gene encodes a subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), which functions in the transfer of electrons from NADH to the respiratory chain. The protein is required for complex I assembly and electron transfer activity. The protein binds the signal transducers and activators of transcription 3 (STAT3) transcription factor, and can function as a tumor suppressor. The human protein purified from mitochondria migrates at approximately 16 kDa. Transcripts originating from an upstream promoter and capable of expressing a protein with a longer N-terminus have been found, but their biological validity has not been determined. [provided by RefSeq, Oct 2009]

Uniprot Description

GRIM-19: Accessory subunit of the mitochondrial membrane respiratory chain NADH dehydrogenase (Complex I), that is believed not to be involved in catalysis. Complex I functions in the transfer of electrons from NADH to the respiratory chain. The immediate electron acceptor for the enzyme is believed to be ubiquinone. Involved in the interferon/all-trans-retinoic acid (IFN/RA) induced cell death. This apoptotic activity is inhibited by interaction with viral IRF1. Prevents the transactivation of STAT3 target genes. May play a role in CARD15-mediated innate mucosal responses and serve to regulate intestinal epithelial cell responses to microbes. Defects in NDUFA13 may be a cause of susceptibility to Hurthle cell thyroid carcinoma (HCTC). Hurthle cell thyroid carcinoma accounts for approximately 3% of all thyroid cancers. Although they are classified as variants of follicular neoplasms, they are more often multifocal and somewhat more aggressive and are less likely to take up iodine than are other follicular neoplasms. Belongs to the complex I NDUFA13 subunit family.

Protein type: Oxidoreductase; Mitochondrial; Membrane protein, integral

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; mitochondrion; cytoplasm; mitochondrial membrane; mitochondrial inner membrane; integral to membrane; mitochondrial respiratory chain complex I; mitochondrial respiratory chain

Molecular Function: protein binding; NADH dehydrogenase (ubiquinone) activity; ATP binding; NADH dehydrogenase activity

Biological Process: cellular metabolic process; positive regulation of protein catabolic process; positive regulation of caspase activity; negative regulation of cell growth; negative regulation of transcription, DNA-dependent; protein import into mitochondrial inner membrane

Disease: Thyroid Carcinoma, Hurthle Cell