Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NDST4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateNDST4 is supported by BioGPS gene expression data to be expressed in HepG2)

Rabbit NDST4 Polyclonal Antibody | anti-NDST4 antibody

NDST4 antibody - N-terminal region

Gene Names
NDST4; N-HSST; NDST-4; NHSST4; N-HSST 4
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NDST4; Polyclonal Antibody; NDST4 antibody - N-terminal region; anti-NDST4 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EDWTIFQYNHSTYQPVLLTELQTEKSLSSLSSKTLFATVIQDLGLHDGIQ
Sequence Length
872
Applicable Applications for anti-NDST4 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 90%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NDST4
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NDST4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateNDST4 is supported by BioGPS gene expression data to be expressed in HepG2)

Western Blot (WB) (WB Suggested Anti-NDST4 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:312500Positive Control: HepG2 cell lysateNDST4 is supported by BioGPS gene expression data to be expressed in HepG2)
Related Product Information for anti-NDST4 antibody
This is a rabbit polyclonal antibody against NDST4. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NDST4 is an essential bifunctional enzyme that catalyzes both the N-deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. It modifies the GlcNAc-GlcA dissacharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. NDST4 has low deacetylase activity but high sulfotransferase activity.
Product Categories/Family for anti-NDST4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
101kDa
NCBI Official Full Name
bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
NCBI Official Synonym Full Names
N-deacetylase and N-sulfotransferase 4
NCBI Official Symbol
NDST4
NCBI Official Synonym Symbols
N-HSST; NDST-4; NHSST4; N-HSST 4
NCBI Protein Information
bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
UniProt Protein Name
Bifunctional heparan sulfate N-deacetylase/N-sulfotransferase 4
UniProt Gene Name
NDST4
UniProt Synonym Gene Names
HSST4; NDST-4; N-HSST 4
UniProt Entry Name
NDST4_HUMAN

Uniprot Description

NDST4: Essential bifunctional enzyme that catalyzes both the N- deacetylation and the N-sulfation of glucosamine (GlcNAc) of the glycosaminoglycan in heparan sulfate. Modifies the GlcNAc-GlcA disaccharide repeating sugar backbone to make N-sulfated heparosan, a prerequisite substrate for later modifications in heparin biosynthesis. Has low deacetylase activity but high sulfotransferase activity. Belongs to the sulfotransferase 1 family. NDST subfamily.

Protein type: EC 2.8.2.8; Glycan Metabolism - heparan sulfate biosynthesis; Hydrolase; Transferase; Membrane protein, integral

Chromosomal Location of Human Ortholog: 4q26

Cellular Component: Golgi membrane; integral to membrane

Molecular Function: deacetylase activity; [heparan sulfate]-glucosamine N-sulfotransferase activity

Biological Process: heparin biosynthetic process; heparan sulfate proteoglycan biosynthetic process

Research Articles on NDST4

Similar Products

Product Notes

The NDST4 ndst4 (Catalog #AAA3209600) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NDST4 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's NDST4 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NDST4 ndst4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EDWTIFQYNH STYQPVLLTE LQTEKSLSSL SSKTLFATVI QDLGLHDGIQ. It is sometimes possible for the material contained within the vial of "NDST4, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.