Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-NAPB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SH-SYSY cell lysate)

Rabbit NAPB Polyclonal Antibody | anti-NAPB antibody

NAPB antibody - N-terminal region

Gene Names
NAPB; SNAPB; SNAP-BETA
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
NAPB; Polyclonal Antibody; NAPB antibody - N-terminal region; anti-NAPB antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: MDNAGKEREAVQLMAEAEKRVKASHSFLRGLFGGNTRIEEACEMYTRAAN
Sequence Length
298
Applicable Applications for anti-NAPB antibody
Western Blot (WB)
Homology
Dog: 100%; Guinea Pig: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human NAPB
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-NAPB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SH-SYSY cell lysate)

Western Blot (WB) (WB Suggested Anti-NAPB Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: SH-SYSY cell lysate)
Related Product Information for anti-NAPB antibody
This is a rabbit polyclonal antibody against NAPB. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: NAPB is required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
Product Categories/Family for anti-NAPB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
33kDa
NCBI Official Full Name
beta-soluble NSF attachment protein isoform b
NCBI Official Synonym Full Names
NSF attachment protein beta
NCBI Official Symbol
NAPB
NCBI Official Synonym Symbols
SNAPB; SNAP-BETA
NCBI Protein Information
beta-soluble NSF attachment protein
UniProt Protein Name
Beta-soluble NSF attachment protein
Protein Family
UniProt Gene Name
NAPB
UniProt Synonym Gene Names
SNAPB; SNAP-beta
UniProt Entry Name
SNAB_HUMAN

NCBI Description

This gene encodes a member of the soluble N-ethyl-maleimide-sensitive fusion attachment protein (SNAP) family. SNAP proteins play a critical role in the docking and fusion of vesicles to target membranes as part of the 20S NSF-SNAP-SNARE complex. This gene encodes the SNAP beta isoform which has been shown to be preferentially expressed in brain tissue. The encoded protein also interacts with the GluR2 α-amino-3-hydroxy-5-methyl-4-isoxazolepropionate (AMPA) receptor subunit C-terminus and may play a role as a chaperone in the molecular processing of the AMPA receptor. [provided by RefSeq, Mar 2017]

Uniprot Description

NAPB: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus. Belongs to the SNAP family.

Protein type: Endoplasmic reticulum

Chromosomal Location of Human Ortholog: 20p12.3-p11.21

Cellular Component: SNARE complex; vacuolar membrane

Molecular Function: syntaxin binding; soluble NSF attachment protein activity

Biological Process: intracellular protein transport

Similar Products

Product Notes

The NAPB napb (Catalog #AAA3224516) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The NAPB antibody - N-terminal region reacts with Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's NAPB can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the NAPB napb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: MDNAGKEREA VQLMAEAEKR VKASHSFLRG LFGGNTRIEE ACEMYTRAAN. It is sometimes possible for the material contained within the vial of "NAPB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.