Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TSSK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Rabbit TSSK2 Polyclonal Antibody | anti-TSSK2 antibody

TSSK2 antibody - middle region

Gene Names
TSSK2; TSK2; DGS-G; SPOGA2; STK22B
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TSSK2; Polyclonal Antibody; TSSK2 antibody - middle region; anti-TSSK2 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DHRPDHKLGAKTQHRLLVVPENENRMEDRLAETSRAKDHHISGAEVGKAS
Sequence Length
358
Applicable Applications for anti-TSSK2 antibody
Western Blot (WB)
Homology
Cow: 79%; Dog: 93%; Guinea Pig: 77%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 86%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human TSSK2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TSSK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)

Western Blot (WB) (WB Suggested Anti-TSSK2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:1562500Positive Control: HepG2 cell lysate)
Related Product Information for anti-TSSK2 antibody
This is a rabbit polyclonal antibody against TSSK2. It was validated on Western Blot

Target Description: TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
39kDa
NCBI Official Full Name
testis-specific serine/threonine-protein kinase 2
NCBI Official Synonym Full Names
testis specific serine kinase 2
NCBI Official Symbol
TSSK2
NCBI Official Synonym Symbols
TSK2; DGS-G; SPOGA2; STK22B
NCBI Protein Information
testis-specific serine/threonine-protein kinase 2
UniProt Protein Name
Testis-specific serine/threonine-protein kinase 2
UniProt Gene Name
TSSK2
UniProt Synonym Gene Names
DGSG; SPOGA2; STK22B; TSK-2; TSK2; TSSK-2; Testis-specific kinase 2; DGS-G
UniProt Entry Name
TSSK2_HUMAN

NCBI Description

TSSK2 belongs to a family of serine/threonine kinases highly expressed in testis (Hao et al., 2004 [PubMed 15044604]).[supplied by OMIM, Mar 2008]

Uniprot Description

TSSK2: Testis-specific serine/threonine-protein kinase required during spermatid development. Phosphorylates TSKS at 'Ser-288' and SPAG16. Involved in the late stages of spermatogenesis, during the reconstruction of the cytoplasm. During spermatogenesis, required for the transformation of a ring-shaped structure around the base of the flagellum originating from the chromatoid body. Belongs to the protein kinase superfamily. CAMK Ser/Thr protein kinase family.

Protein type: EC 2.7.11.1; Protein kinase, CAMK; Protein kinase, Ser/Thr (non-receptor); Kinase, protein; CAMK group; TSSK family

Chromosomal Location of Human Ortholog: 22q11.21

Cellular Component: centriole; cytoplasm; acrosome; nucleus

Molecular Function: protein serine/threonine kinase activity; protein binding; magnesium ion binding; ATP binding

Biological Process: multicellular organismal development; protein amino acid autophosphorylation; protein amino acid phosphorylation; spermatid development

Research Articles on TSSK2

Similar Products

Product Notes

The TSSK2 tssk2 (Catalog #AAA3211535) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TSSK2 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TSSK2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TSSK2 tssk2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DHRPDHKLGA KTQHRLLVVP ENENRMEDRL AETSRAKDHH ISGAEVGKAS. It is sometimes possible for the material contained within the vial of "TSSK2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.