Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: SRSF1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Rabbit anti-Human SRSF1 Polyclonal Antibody | anti-SRSF1 antibody

SRSF1 Antibody - middle region

Gene Names
SRSF1; ASF; SF2; SFRS1; SF2p33; SRp30a
Reactivity
Human
Applications
Western Blot
Purity
Affinity purified
Synonyms
SRSF1; Polyclonal Antibody; SRSF1 Antibody - middle region; anti-SRSF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Human
Clonality
Polyclonal
Purity/Purification
Affinity purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: GGGGGGAPRGRYGPPSRRSENRVVVSGLPPSGSWQDLKDHMREAGDVCYA
Sequence Length
292
Applicable Applications for anti-SRSF1 antibody
Western Blot (WB)
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human SRSF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: SRSF1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: SRSF1Sample Tissue: Human 293T Whole Cell lysatesAntibody Dilution: 1ug/ml)
Related Product Information for anti-SRSF1 antibody
This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13.
Product Categories/Family for anti-SRSF1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
32 kDa
NCBI Official Full Name
splicing factor, arginine/serine-rich 1 (splicing factor 2, alternate splicing factor), isoform CRA_c
NCBI Official Synonym Full Names
serine and arginine rich splicing factor 1
NCBI Official Symbol
SRSF1
NCBI Official Synonym Symbols
ASF; SF2; SFRS1; SF2p33; SRp30a
NCBI Protein Information
serine/arginine-rich splicing factor 1
UniProt Protein Name
Serine/arginine-rich splicing factor 1
UniProt Gene Name
SRSF1
UniProt Synonym Gene Names
ASF; SF2; SF2P33; SFRS1; ASF-1
UniProt Entry Name
SRSF1_HUMAN

NCBI Description

This gene encodes a member of the arginine/serine-rich splicing factor protein family. The encoded protein can either activate or repress splicing, depending on its phosphorylation state and its interaction partners. Multiple transcript variants have been found for this gene. There is a pseudogene of this gene on chromosome 13. [provided by RefSeq, Jun 2014]

Uniprot Description

SF2: a serine-arginine-rich splicing regulatory protein. Plays a role in preventing exon skipping, ensuring the accuracy of splicing and regulating alternative splicing. Interacts with other spliceosomal components, via the RS domains, to form a bridge between the 5' and 3' splice site binding components, U1 snRNP and U2AF. Can stimulate binding of U1 snRNP to a 5'-splice-site-containing pre-mRNA. Extensively phosphorylated on serine residues in the serine-arginine rich region. Three splice variant isoforms have been described. ASF/SF2 splicing enhancer (ASE) which can specifically activate ASE-dependent splicing. Isoform ASF-2 and isoform ASF-3 act as splicing repressors.

Protein type: RNA-binding; RNA splicing; Spliceosome

Chromosomal Location of Human Ortholog: 17q22

Cellular Component: nucleoplasm; cytoplasm; nuclear speck; nucleus

Molecular Function: mRNA binding; protein binding; RS domain binding; RNA binding; nucleotide binding

Biological Process: transcription from RNA polymerase II promoter; in utero embryonic development; RNA splicing; regulation of mRNA stability; regulation of translation; nuclear mRNA splicing, via spliceosome; nuclear mRNA 5'-splice site recognition; mRNA splice site selection; regulation of nuclear mRNA splicing, via spliceosome; mRNA export from nucleus; regulation of transcription, DNA-dependent; gene expression; mRNA 3'-end processing; mRNA processing; termination of RNA polymerase II transcription; cardiac muscle contraction

Research Articles on SRSF1

Similar Products

Product Notes

The SRSF1 srsf1 (Catalog #AAA3219922) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The SRSF1 Antibody - middle region reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's SRSF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the SRSF1 srsf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: GGGGGGAPRG RYGPPSRRSE NRVVVSGLPP SGSWQDLKDH MREAGDVCYA. It is sometimes possible for the material contained within the vial of "SRSF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.