Rabbit anti-Human MYOZ2 Polyclonal Antibody | anti-MYOZ2 antibody

MYOZ2 (Myozenin 2, Myozenin-2, Calsarcin-1, FATZ-related Protein 2, C4orf5) (PE)

Cat. Num. AAA6386401

• Gene Names: MYOZ2; CS-1; CMH16; C4orf5
• Reactivity: Human
• Applications: Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: MYOZ2; Polyclonal Antibody; MYOZ2 (Myozenin 2; Myozenin-2; Calsarcin-1; FATZ-related Protein 2; C4orf5) (PE); anti-MYOZ2 antibody

• Host: Rabbit
• Reactivity: Human
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: Recognizes human MYOZ2.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-MYOZ2 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length human MYOZ2, aa1-264 (NP_057683.1).
• Immunogen Sequence: MLSHNTMMKQRKQQATAIMKEVHGNDVDGMDLGKKVSIPRDIMLEELSHLSNRGARLFKMRQRRSDKYTFENFQYQSRAQINHSIAMQNGKVDGSNLEGGSQQAPLTPPNTPDPRSPPNPDNIAPGYSGPLKEIPPEKFNTTAVPKYYQSPWEQAISNDPELLEALYPKLFKPEGKAELPDYRSFNRVATPFGGFEKASRMVKFKVPDFELLLLTDPRFMSFVNPLSGRRSFNRTPKGWISENIPIVITTEPTDDTTVPESEDL
• Conjugate: PE
• Note: Preservative Free
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of MYOZ2 expression in transfected 293T cell line by MYOZ2 polyclonal antibody. Lane 1: MYOZ2 transfected lysate (29.9kD). Lane 2: Non-transfected lysate.)

Related Product Information for anti-MYOZ2 antibody

Myozenins may serve as intracellular binding proteins involved in linking Z-disk proteins such as ACTN2, FLNC, TCAP and localizing calcineurin signaling to the sarcomere. It may play a role in myofibrillogenesis. It is expressed specifically in heart and skeletal muscle.

Product Categories/Family for anti-MYOZ2 antibody

Antibodies; Signal Transduction

NCBI and Uniprot Product Information

• NCBI GI #: 7706595
• NCBI GeneID: 51778
• NCBI Accession #: NP_057683.1
• NCBI GenBank Nucleotide #: NM_016599.2
• UniProt Accession #: Q9NPC6; O43415; Q9HB92
• Molecular Weight: 29,898 Da
• NCBI Official Full Name: myozenin-2
• NCBI Official Synonym Full Names: myozenin 2
• NCBI Official Symbol: MYOZ2
• NCBI Official Synonym Symbols: CS-1; CMH16; C4orf5
• NCBI Protein Information: myozenin-2
• UniProt Protein Name: Myozenin-2
• Protein Family: Myozenin
• UniProt Gene Name: MYOZ2

NCBI Description

The protein encoded by this gene belongs to a family of sarcomeric proteins that bind to calcineurin, a phosphatase involved in calcium-dependent signal transduction in diverse cell types. These family members tether calcineurin to alpha-actinin at the z-line of the sarcomere of cardiac and skeletal muscle cells, and thus they are important for calcineurin signaling. Mutations in this gene cause cardiomyopathy familial hypertrophic type 16, a hereditary heart disorder. [provided by RefSeq, Aug 2011]

Uniprot Description

Myozenins may serve as intracellular binding proteins involved in linking Z line proteins such as alpha-actinin, gamma-filamin, TCAP/telethonin, LDB3/ZASP and localizing calcineurin signaling to the sarcomere. Plays an important role in the modulation of calcineurin signaling. May play a role in myofibrillogenesis.