Rabbit Myelin oligodendrocyte glycoprotein/MOG Polyclonal Antibody | anti-MOG antibody

Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody

Cat. Num. AAA1751453

• Gene Names: MOG; BTN6; BTNL11; MOGIG2; NRCLP7
• Reactivity: Human, Mouse, Rat
• Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Flow Cytometry, Functional Assay
• Purity: Immunogen Affinity Purified
• Synonyms: Myelin oligodendrocyte glycoprotein/MOG; Polyclonal Antibody; Anti-Myelin oligodendrocyte glycoprotein/MOG Antibody; Myelin-oligodendrocyte glycoprotein; MOG; Myelin oligodendrocyte glycoprotein; anti-MOG antibody

• Host: Rabbit
• Reactivity: Human, Mouse, Rat
• Clonality: Polyclonal
• Isotype: IgG
• Specificity: No cross reactivity with other proteins.
• Purity/Purification: Immunogen Affinity Purified
• Form/Format: Lyophilized
• Sequence Length: 208

• Applicable Applications for anti-MOG antibody: Western Blot (WB), Immunohistochemistry (IHC) Frozen/Paraffin, Immunocytochemistry (ICC), Flow Cytometry (FC/FACS)
• Application Notes: WB: Concentration: 0.1-0.5 ug/ml; Tested Species: Mouse, Rat; IHC-P: Concentration: 0.5-1 ug/ml; Tested Species: Human, Mouse, Rat; Antigen: By heat; FC: Concentration: 1-3ug/1x106 cells; Tested Species: Human; ; Tested Species: In-house tested species with positive results; By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections.; Other applications have not been tested.; Optimal dilutions should be determined by end users.; ; Enhanced Chemiluminescent kit with anti-Rabbit IgG (MBS176460) for Western Blot (WB), and HRP conjugated anti-Rabbit IgG Super Vision Assay Kit for IHC-P.
• Immunogen: A synthetic peptide corresponding to a sequence of human Myelin oligodendrocyte glycoprotein/MOG (RVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGK).
• Reconstitution: Add 0.2ml of distilled water will yield a concentration of 500ug/ml.
• Relevant Detection Systems: It is recommended to use an Enhanced Chemiluminescent Kit with anti-Rabbit IgG (MBS176460) for Western blot, and HRP Conjugated anti-Rabbit IgG Super Vision Assay Kit (MBS176453) for IHC-P, IHC-F and ICC.
• Contents: Each vial contains 4 mg Trehalose, 0.9mg NaCl, 0.2mg Na₂HPO₄, 0.05mg NaN₃
• Preparation and Storage: Store at -20 degree C for one year. After reconstitution, at 4 degree C for one month. It can also be aliquotted and stored frozen at -20 degree C for a longer time.; Avoid repeated freezing and thawing.

Related Product Information for anti-MOG antibody

Description: Rabbit IgG polyclonal antibody for Myelin oligodendrocyte glycoprotein/MOG detection. Tested with WB, IHC-P, IHC-F, ICC, FCM in Human; Mouse; Rat.
Background: Myelin oligodendrocyte glycoprotein (MOG) is a glycoprotein believed to be important in the myelination of nerves in the central nervous system (CNS). In humans this protein is encoded by the MOG gene. This gene is mapped to 6p22.1. It is speculated to serve as a necessary "adhesion molecule" to provide structural integrity to the myelin sheath and is known to develop late on the oligodendrocyte. The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified.

References

1. Pham-Dinh D, Della Gaspera B, Kerlero de Rosbo N, Dautigny A (September 1995). "Structure of the human myelin/oligodendrocyte glycoprotein gene and multiple alternative spliced isoforms". Genomics. 2. Pham-Dinh D, Jones EP, Pitiot G, Della Gaspera B, Daubas P, Mallet J, Le Paslier D, Fischer Lindahl K, Dautigny A (1995). 3. "Physical mapping of the human and mouse MOG gene at the distal end of the MHC class Ib region". 4. Immunogenetics. Roth MP, Malfroy L, Offer C, Sevin J, Enault G, Borot N, Pontarotti P, Coppin H (July 1995). 5. "The human myelin oligodendrocyte glycoprotein (MOG) gene: complete nucleotide sequence and structural characterization". Genomics. 6. Berger, T., Innsbruck Medical University Dept. of Neurology interviewed by S. Gillooly, Nov. 24, 2008.

NCBI and Uniprot Product Information

• NCBI GI #: 56788389
• NCBI GeneID: 4340
• NCBI Accession #: NP_001008229.1
• NCBI GenBank Nucleotide #: NM_001008228.2
• UniProt Accession #: Q16653; O00713; O00714; O00715; Q13054; Q13055; A6NDR4; A6NNJ9; A8MY31; B0UZR9; E9PGF0; F8W9D5
• NCBI Official Full Name: myelin-oligodendrocyte glycoprotein isoform alpha3
• NCBI Official Synonym Full Names: myelin oligodendrocyte glycoprotein
• NCBI Official Symbol: MOG
• NCBI Official Synonym Symbols: BTN6; BTNL11; MOGIG2; NRCLP7
• NCBI Protein Information: myelin-oligodendrocyte glycoprotein
• UniProt Protein Name: Myelin-oligodendrocyte glycoprotein
• Protein Family: Molybdopterin adenylyltransferase
• UniProt Gene Name: MOG

NCBI Description

The product of this gene is a membrane protein expressed on the oligodendrocyte cell surface and the outermost surface of myelin sheaths. Due to this localization, it is a primary target antigen involved in immune-mediated demyelination. This protein may be involved in completion and maintenance of the myelin sheath and in cell-cell communication. Alternatively spliced transcript variants encoding different isoforms have been identified. [provided by RefSeq, Jul 2008]

Uniprot Description

Mediates homophilic cell-cell adhesion (). Minor component of the myelin sheath. May be involved in completion and/or maintenance of the myelin sheath and in cell-cell communication.