Western Blot (WB)
(WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Rabbit MYEF2 Polyclonal Antibody | anti-MYEF2 antibody
MYEF2 antibody - N-terminal region
Gene Names
MYEF2; MEF-2; MST156; myEF-2; MSTP156; HsT18564
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYEF2; Polyclonal Antibody; MYEF2 antibody - N-terminal region; anti-MYEF2 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: PAEAEKQQPQHSSSSNGVKMENDESAKEEKSDLKEKSTGSKKANRFHPYS
Sequence Length
600
Applicable Applications for anti-MYEF2 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 77%; Guinea Pig: 92%; Horse: 86%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human MYEF2
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Western Blot (WB)
(WB Suggested Anti-MYEF2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: PANC1 cell lysate)
Related Product Information for anti-MYEF2 antibody
This is a rabbit polyclonal antibody against MYEF2. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MYEF2 is the transcriptional repressor of the myelin basic protein gene (MBP). MYEF2 binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.
Target Description: MYEF2 is the transcriptional repressor of the myelin basic protein gene (MBP). MYEF2 binds to the proximal MB1 element 5'-TTGTCC-3' of the MBP promoter. Its binding to MB1 and function are inhibited by PURA.
Product Categories/Family for anti-MYEF2 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
64kDa
NCBI Official Full Name
myelin expression factor 2 isoform a
NCBI Official Synonym Full Names
myelin expression factor 2
NCBI Official Symbol
MYEF2
NCBI Official Synonym Symbols
MEF-2; MST156; myEF-2; MSTP156; HsT18564
NCBI Protein Information
myelin expression factor 2
UniProt Protein Name
Myelin expression factor 2
Protein Family
UniProt Gene Name
MYEF2
UniProt Synonym Gene Names
KIAA1341; MEF-2; MyEF-2
UniProt Entry Name
MYEF2_HUMAN
Research Articles on MYEF2
Similar Products
Product Notes
The MYEF2 myef2 (Catalog #AAA3200736) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYEF2 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYEF2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYEF2 myef2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: PAEAEKQQPQ HSSSSNGVKM ENDESAKEEK SDLKEKSTGS KKANRFHPYS. It is sometimes possible for the material contained within the vial of "MYEF2, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
