Western Blot (WB)
(WB Suggested Anti-MYBL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Rabbit MYBL1 Polyclonal Antibody | anti-MYBL1 antibody
MYBL1 antibody - middle region
Gene Names
MYBL1; AMYB; A-MYB
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYBL1; Polyclonal Antibody; MYBL1 antibody - middle region; anti-MYBL1 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: DMQSENRFTTSLLMIPLLEIHDNRCNLIPEKQDINSTNKTYTLTKKKPNP
Sequence Length
752
Applicable Applications for anti-MYBL1 antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 86%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 93%; Rat: 93%
Immunogen
The immunogen is a synthetic peptide directed towards the middle region of human MYBL1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Western Blot (WB)
(WB Suggested Anti-MYBL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Western Blot (WB)
(WB Suggested Anti-MYBL1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: Human Muscle)
Related Product Information for anti-MYBL1 antibody
This is a rabbit polyclonal antibody against MYBL1. It was validated on Western Blot using a cell lysate as a positive control.
Target Description: MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Target Description: MYBL1 is strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. It could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells.
Product Categories/Family for anti-MYBL1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
86kDa
NCBI Official Full Name
myb-related protein A isoform 1
NCBI Official Synonym Full Names
MYB proto-oncogene like 1
NCBI Official Symbol
MYBL1
NCBI Official Synonym Symbols
AMYB; A-MYB
NCBI Protein Information
myb-related protein A
UniProt Protein Name
Myb-related protein A
Protein Family
UniProt Gene Name
MYBL1
UniProt Synonym Gene Names
AMYB; A-Myb
UniProt Entry Name
MYBA_HUMAN
Uniprot Description
A-Myb: Strong transcriptional activator; DNA-binding protein that specifically recognize the sequence 5'-YAAC[GT]G-3'. Could have a role in the proliferation and/or differentiation of neurogenic, spermatogenic and B-lymphoid cells. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Transcription factor
Chromosomal Location of Human Ortholog: 8q13.1
Cellular Component: nucleus
Molecular Function: chromatin binding
Biological Process: transcription, DNA-dependent; positive regulation of transcription, DNA-dependent; positive regulation of transcription from RNA polymerase II promoter; gene expression
Research Articles on MYBL1
Similar Products
Product Notes
The MYBL1 mybl1 (Catalog #AAA3209947) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYBL1 antibody - middle region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYBL1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYBL1 mybl1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: DMQSENRFTT SLLMIPLLEI HDNRCNLIPE KQDINSTNKT YTLTKKKPNP. It is sometimes possible for the material contained within the vial of "MYBL1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
