Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (WB Suggested Anti-TMF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that TMF1 is expressed in MCF7)

Rabbit TMF1 Polyclonal Antibody | anti-TMF1 antibody

TMF1 antibody - N-terminal region

Gene Names
TMF1; TMF; ARA160
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
TMF1; Polyclonal Antibody; TMF1 antibody - N-terminal region; anti-TMF1 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: TPETTESQVKDSSLCVSGETLAAGTSSPKTEGKHEETVNKESDMKVPTVS
Sequence Length
1093
Applicable Applications for anti-TMF1 antibody
Western Blot (WB)
Homology
Cow: 86%; Dog: 86%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Pig: 100%; Rat: 85%
Immunogen
The immunogen is a synthetic peptide directed towards the N terminal region of human TMF1
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(WB Suggested Anti-TMF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that TMF1 is expressed in MCF7)

Western Blot (WB) (WB Suggested Anti-TMF1 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:12500Positive Control: MCF7 cell lysateThere is BioGPS gene expression data showing that TMF1 is expressed in MCF7)
Related Product Information for anti-TMF1 antibody
This is a rabbit polyclonal antibody against TMF1. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: TMF1 binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP).

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Full Name
TATA element modulatory factor isoform 1
NCBI Official Synonym Full Names
TATA element modulatory factor 1
NCBI Official Symbol
TMF1
NCBI Official Synonym Symbols
TMF; ARA160
NCBI Protein Information
TATA element modulatory factor
UniProt Protein Name
TATA element modulatory factor
UniProt Gene Name
TMF1
UniProt Synonym Gene Names
ARA160; TMF
UniProt Entry Name
TMF1_HUMAN

Uniprot Description

TMF1: Potential coactivator of the androgen receptor. Mediates STAT3 degradation. May play critical roles in two RAB6-dependent retrograde transport processes: one from endosomes to the Golgi and the other from the Golgi to the ER. This protein binds the HIV-1 TATA element and inhibits transcriptional activation by the TATA-binding protein (TBP). 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Transcription factor; Nuclear receptor co-regulator

Chromosomal Location of Human Ortholog: 3p14.1

Cellular Component: Golgi membrane; Golgi apparatus; endoplasmic reticulum; nucleus

Molecular Function: protein binding; DNA binding; transcription cofactor activity

Biological Process: acrosome formation; transcription from RNA polymerase II promoter; positive regulation of cytokine production; luteinizing hormone secretion; sperm motility; Leydig cell differentiation; regulation of transcription, DNA-dependent; defense response to bacterium; spermatid nuclear differentiation; negative regulation of apoptosis

Research Articles on TMF1

Similar Products

Product Notes

The TMF1 tmf1 (Catalog #AAA3213733) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The TMF1 antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Pig, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's TMF1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the TMF1 tmf1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: TPETTESQVK DSSLCVSGET LAAGTSSPKT EGKHEETVNK ESDMKVPTVS. It is sometimes possible for the material contained within the vial of "TMF1, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.