Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Host: RabbitTarget Name: MYBPC3Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Rabbit MYBPC3 Polyclonal Antibody | anti-MYBPC3 antibody

MYBPC3 Antibody - C-terminal region

Gene Names
MYBPC3; FHC; CMH4; CMD1MM; LVNC10; MYBP-C
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Applications
Western Blot
Purity
Affinity Purified
Synonyms
MYBPC3; Polyclonal Antibody; MYBPC3 Antibody - C-terminal region; anti-MYBPC3 antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Concentration
Batch dependent within range: 100 ul at 0.5-1 mg/ml (varies by lot)
Sequence
Synthetic peptide located within the following region: KGKWVDLSSKVGQHLQLHDSYDRASKVYLFELHITDAQPAFTGSYRCEVS
Sequence Length
365
Applicable Applications for anti-MYBPC3 antibody
Western Blot (WB)
Protein Size (#AA)
365 amino acids
Predicted Homology Based on Immunogen Sequence
Cow: 93%; Dog: 86%; Guinea Pig: 93%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
Immunogen
The immunogen is a synthetic peptide directed towards the C-terminal region of human MYBPC3
Replacement Item
This antibody may replace item sc-112857 from Santa Cruz Biotechnology
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Western Blot (WB)

(Host: RabbitTarget Name: MYBPC3Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)

Western Blot (WB) (Host: RabbitTarget Name: MYBPC3Sample Type: MCF7 Whole cell lysatesAntibody Dilution: 1.0ug/ml)
Related Product Information for anti-MYBPC3 antibody
This is a rabbit polyclonal antibody against MYBPC3. It was validated on Western Blot

Target Description: MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. Regulatory phosphorylation of the cardiac isoform in vivo by cAMP-dependent protein kinase (PKA) upon adrenergic stimulation may be linked to modulation of cardiac contraction. Mutations in MYBPC3 are one cause of familial hypertrophic cardiomyopathy.
Product Categories/Family for anti-MYBPC3 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
40kDa
NCBI Official Full Name
myosin-binding protein C, cardiac-type
NCBI Official Synonym Full Names
myosin binding protein C, cardiac
NCBI Official Symbol
MYBPC3
NCBI Official Synonym Symbols
FHC; CMH4; CMD1MM; LVNC10; MYBP-C
NCBI Protein Information
myosin-binding protein C, cardiac-type
UniProt Protein Name
Myosin-binding protein C, cardiac-type
Protein Family
UniProt Gene Name
MYBPC3
UniProt Synonym Gene Names
Cardiac MyBP-C
UniProt Entry Name
MYPC3_HUMAN

NCBI Description

MYBPC3 encodes the cardiac isoform of myosin-binding protein C. Myosin-binding protein C is a myosin-associated protein found in the cross-bridge-bearing zone (C region) of A bands in striated muscle. MYBPC3, the cardiac isoform, is expressed exclussively in heart muscle. Regulatory phosphorylation of the cardiac isoform in vivo by cAMP-dependent protein kinase (PKA) upon adrenergic stimulation may be linked to modulation of cardiac contraction. Mutations in MYBPC3 are one cause of familial hypertrophic cardiomyopathy. [provided by RefSeq, Jul 2008]

Uniprot Description

MYBPC3: Thick filament-associated protein located in the crossbridge region of vertebrate striated muscle a bands. In vitro it binds MHC, F-actin and native thin filaments, and modifies the activity of actin-activated myosin ATPase. It may modulate muscle contraction or may play a more structural role. Belongs to the immunoglobulin superfamily. MyBP family.

Protein type: Myosin-binding

Chromosomal Location of Human Ortholog: 11p11.2

Cellular Component: sarcomere; striated muscle thick filament; cytosol; A band

Molecular Function: identical protein binding; ATPase activator activity; myosin binding; structural constituent of muscle; metal ion binding; titin binding; actin binding; myosin heavy chain binding

Biological Process: heart morphogenesis; regulation of heart rate; positive regulation of ATPase activity; regulation of muscle filament sliding; regulation of striated muscle contraction; ventricular cardiac muscle morphogenesis; sarcomere organization; cell adhesion; myosin filament assembly; muscle filament sliding; cardiac muscle contraction

Disease: Left Ventricular Noncompaction 10; Cardiomyopathy, Familial Hypertrophic, 4

Research Articles on MYBPC3

Similar Products

Product Notes

The MYBPC3 mybpc3 (Catalog #AAA3205809) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MYBPC3 Antibody - C-terminal region reacts with Tested: Human; Predicted: Cow, Dog, Guinea Pig, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MYBPC3 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the MYBPC3 mybpc3 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KGKWVDLSSK VGQHLQLHDS YDRASKVYLF ELHITDAQPA FTGSYRCEVS. It is sometimes possible for the material contained within the vial of "MYBPC3, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.