Western Blot (WB)
(Western Blot analysis of MUTED expression in transfected 293T cell line by MUTED polyclonal antibody. Lane 1: MUTED transfected lysate (20.57kD). Lane 2: Non-transfected lysate.)
Mouse anti-Human MUTED Polyclonal Antibody | anti-muted antibody
MUTED (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 5, BLOC-1 Subunit 5, Protein Muted Homolog, BLOC1S5, MU, dJ303A1.3, DKFZp686E2287, FLJ18427)
Gene Names
muted; CG34131; DmelCG34131; Dromel_CG7071_FBtr0084211_uORF
Reactivity
Human
Applications
Western Blot
Purity
Affinity PurifiedPurified by Protein A affinity chromatography.
Synonyms
MUTED; Polyclonal Antibody; MUTED (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 5; BLOC-1 Subunit 5; Protein Muted Homolog; BLOC1S5; MU; dJ303A1.3; DKFZp686E2287; FLJ18427); Anti -MUTED (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 5; anti-muted antibody
Host
Mouse
Reactivity
Human
Clonality
Polyclonal
Isotype
IgG
Specificity
Recognizes human MUTED.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
MSGGGTETPVGCEAAPGGGSKKRDSLGTAGSAHLIIKDLGEIHSRLLDHRPVIQGETRYFVKEFEEKRGLREMRVLENLKNMIHETNEHTLPKCRDTMRDSLSQVLQRLQAANDSVCRLQQREQERKKIHSDHLVASEKQHMLQWDNFMKEQPNKRAEVDEEHRKAMERLKEQYAEMEKDLAKFSTF
Applicable Applications for anti-muted antibody
Western Blot (WB)
Application Notes
Suitable for use in Western Blot.
Immunogen
Full length human MUTED, aa1-187 (NP_958437.1).
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of MUTED expression in transfected 293T cell line by MUTED polyclonal antibody. Lane 1: MUTED transfected lysate (20.57kD). Lane 2: Non-transfected lysate.)
Western Blot (WB)
(Western Blot analysis of MUTED expression in transfected 293T cell line by MUTED polyclonal antibody. Lane 1: MUTED transfected lysate (20.57kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-muted antibody
Component of the BLOC-1 complex, a complex that is required for normal biogenesis of lysosome-related organelles (LRO), such as platelet dense granules and melanosomes. In concert with the AP-3 complex, the BLOC-1 complex is required to target membrane protein cargos into vesicles assembled at cell bodies for delivery into neurites and nerve terminals. The BLOC-1 complex, in association with SNARE proteins, is also proposed to be involved in neurite extension. Plays a role in intracellular vesicle trafficking.
Product Categories/Family for anti-muted antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
18,327 Da
NCBI Official Full Name
muted
NCBI Official Symbol
muted
NCBI Official Synonym Symbols
CG34131; DmelCG34131; Dromel_CG7071_FBtr0084211_uORF
NCBI Protein Information
CG34131 gene product from transcript CG34131-RA; CG34131-PA; muted; muted-PA
UniProt Protein Name
Biogenesis of lysosome-related organelles complex 1 subunit 5
UniProt Gene Name
muted
UniProt Synonym Gene Names
BLOC-1 subunit 5
UniProt Entry Name
BL1S5_DROME
Uniprot Description
Function: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) involved in pigment granule biogenesis. Ref.3
Subunit structure: Component of the biogenesis of lysosome-related organelles complex-1 (BLOC-1) composed of blos1, blos2, blos3, blos4, dysb, muted, pallidin and snapin. Ref.3
Sequence similarities: Belongs to the BLOC1S5 family.
Similar Products
Product Notes
The muted muted (Catalog #AAA6006801) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The MUTED (Biogenesis of Lysosome-related Organelles Complex 1 Subunit 5, BLOC-1 Subunit 5, Protein Muted Homolog, BLOC1S5, MU, dJ303A1.3, DKFZp686E2287, FLJ18427) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's MUTED can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Suitable for use in Western Blot. Researchers should empirically determine the suitability of the muted muted for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: MSGGGTETPV GCEAAPGGGS KKRDSLGTAG SAHLIIKDLG EIHSRLLDHR PVIQGETRYF VKEFEEKRGL REMRVLENLK NMIHETNEHT LPKCRDTMRD SLSQVLQRLQ AANDSVCRLQ QREQERKKIH SDHLVASEKQ HMLQWDNFMK EQPNKRAEVD EEHRKAMERL KEQYAEMEKD LAKFSTF. It is sometimes possible for the material contained within the vial of "MUTED, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
