Immunohistochemistry (IHC)
(Rabbit Anti-MTCP1NB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, strong signal resembling mitochondria staining, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 – 2.0 secProtocol located in Reviews and Data.)
Rabbit MTCP1NB Polyclonal Antibody | anti-CMC4 antibody
MTCP1NB antibody - N-terminal region
Gene Names
CMC4; p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Applications
Immunohistochemistry, Western Blot
Purity
Affinity Purified
Synonyms
MTCP1NB; Polyclonal Antibody; MTCP1NB antibody - N-terminal region; anti-CMC4 antibody
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: KCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKS
Sequence Length
68
Applicable Applications for anti-CMC4 antibody
Immunohistochemistry (IHC), Western Blot (WB)
Homology
Cow: 91%; Dog: 92%; Guinea Pig: 91%; Horse: 91%; Human: 100%; Mouse: 91%; Rabbit: 93%; Rat: 92%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.
Immunohistochemistry (IHC)
(Rabbit Anti-MTCP1NB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, strong signal resembling mitochondria staining, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 – 2.0 secProtocol located in Reviews and Data.)
Immunohistochemistry (IHC)
(Rabbit Anti-MTCP1NB AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, strong signal resembling mitochondria staining, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 – 2.0 secProtocol located in Reviews and Data.)
Related Product Information for anti-CMC4 antibody
This is a rabbit polyclonal antibody against MTCP1NB. It was validated on Western Blot
Target Description: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Target Description: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.
Product Categories/Family for anti-CMC4 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
8kDa
NCBI Official Full Name
cx9C motif-containing protein 4
NCBI Official Synonym Full Names
C-X9-C motif containing 4
NCBI Official Symbol
CMC4
NCBI Official Synonym Symbols
p8; C6.1B; MTCP1; MTCP1B; MTCP1NB; p8MTCP1
NCBI Protein Information
cx9C motif-containing protein 4
UniProt Protein Name
Cx9C motif-containing protein 4
Protein Family
UniProt Gene Name
CMC4
UniProt Synonym Gene Names
C6.1B; MTCP1; MTCP1NB; MTCP-1 type A; p8MTCP1
UniProt Entry Name
CMC4_HUMAN
NCBI Description
This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the downstream 8 kDa protein that localizes to mitochondria.[provided by RefSeq, Mar 2009]
Uniprot Description
MTCPA: Overexpressed in T-cell leukemia bearing a t(X;14) translocation. 2 isoforms of the human protein are produced by alternative splicing.
Protein type: Oncoprotein
Chromosomal Location of Human Ortholog: Xq28
Cellular Component: mitochondrion
Biological Process: cell proliferation
Similar Products
Product Notes
The CMC4 cmc4 (Catalog #AAA3200298) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The MTCP1NB antibody - N-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's MTCP1NB can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Researchers should empirically determine the suitability of the CMC4 cmc4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: KCLQANSYME SKCQAVIQEL RKCCAQYPKG RSVVCSGFEK EEEENLTRKS. It is sometimes possible for the material contained within the vial of "MTCP1NB, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
