Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunohistochemistry (IHC) (Rabbit Anti-RET AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Rabbit RET Polyclonal Antibody | anti-RET antibody

RET antibody - C-terminal region

Gene Names
RET; PTC; MTC1; HSCR1; MEN2A; MEN2B; CDHF12; CDHR16; RET-ELE1
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Applications
Western Blot
Purity
Affinity Purified
Synonyms
RET; Polyclonal Antibody; RET antibody - C-terminal region; anti-RET antibody
Ordering
For Research Use Only!
Host
Rabbit
Reactivity
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Clonality
Polyclonal
Purity/Purification
Affinity Purified
Form/Format
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Sequence
Synthetic peptide located within the following region: EMKLVHRDLAARNILVAEGRKMKISDFGLSRDVYEEDSYVKRSQGRIPVK
Sequence Length
1114
Applicable Applications for anti-RET antibody
Western Blot (WB)
Homology
Cow: 100%; Dog: 100%; Guinea Pig: 90%; Horse: 100%; Human: 100%; Mouse: 90%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Preparation and Storage
For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-RET AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)

Immunohistochemistry (IHC) (Rabbit Anti-RET AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Testis TissueObserved Staining: CytoplasmPrimary Antibody Concentration: 1:600Other Working Concentrations: N/ASecondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 sec)
Related Product Information for anti-RET antibody
This is a rabbit polyclonal antibody against RET. It was validated on Western Blot

Target Description: This gene, a member of the cadherin superfamily, encodes one of the receptor tyrosine kinases, which are cell-surface molecules that transduce signals for cell growth and differentiation. This gene plays a crucial role in neural crest development, and it can undergo oncogenic activation in vivo and in vitro by cytogenetic rearrangement. Mutations in this gene are associated with the disorders multiple endocrine neoplasia, type IIA, multiple endocrine neoplasia, type IIB, Hirschsprung disease, and medullary thyroid carcinoma. Two transcript variants encoding different isoforms have been found for this gene. Additional transcript variants have been described but their biological validity has not been confirmed.
Product Categories/Family for anti-RET antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
123kDa
NCBI Official Synonym Full Names
ret proto-oncogene
NCBI Official Symbol
RET
NCBI Official Synonym Symbols
PTC; MTC1; HSCR1; MEN2A; MEN2B; CDHF12; CDHR16; RET-ELE1
NCBI Protein Information
proto-oncogene tyrosine-protein kinase receptor Ret
UniProt Protein Name
Proto-oncogene tyrosine-protein kinase receptor Ret
Protein Family
UniProt Gene Name
RET
UniProt Synonym Gene Names
CDHF12; CDHR16; PTC; RET51
UniProt Entry Name
RET_HUMAN

NCBI Description

This gene encodes a transmembrane receptor and member of the tyrosine protein kinase family of proteins. Binding of ligands such as GDNF (glial cell-line derived neurotrophic factor) and other related proteins to the encoded receptor stimulates receptor dimerization and activation of downstream signaling pathways that play a role in cell differentiation, growth, migration and survival. The encoded receptor is important in development of the nervous system, and the development of organs and tissues derived from the neural crest. This proto-oncogene can undergo oncogenic activation through both cytogenetic rearrangement and activating point mutations. Mutations in this gene are associated with Hirschsprung disease and central hypoventilation syndrome and have been identified in patients with renal agenesis. [provided by RefSeq, Sep 2017]

Uniprot Description

Ret: a proto-oncogenic receptor tyrosine kinase. Receptor for glial cell line-derived neurotropic factor (GDNF) and its congeners neurturin, persephin and artemin. Part of a multicompetent receptor complex with other membrane-bound ligand-binding GDNF family receptors (aGFRs). Required for development of the kidney and neural crest-derived cell types. Three alternatively spliced isoforms have been described.

Protein type: Membrane protein, integral; Oncoprotein; Protein kinase, tyrosine (receptor); EC 2.7.10.1; Protein kinase, TK; Kinase, protein; TK group; Ret family

Chromosomal Location of Human Ortholog: 10q11.2

Cellular Component: intracellular membrane-bound organelle; integral to plasma membrane; cytoplasm; plasma membrane; endosome membrane; receptor complex; lipid raft

Molecular Function: protein binding; protein-tyrosine kinase activity; receptor activity; transmembrane receptor protein tyrosine kinase activity; calcium ion binding; ATP binding

Biological Process: response to drug; regulation of cell adhesion; caspase activation; positive regulation of neuron maturation; posterior midgut development; peptidyl-tyrosine phosphorylation; positive regulation of cell size; positive regulation of transcription, DNA-dependent; membrane protein proteolysis; MAPKKK cascade; positive regulation of cell adhesion mediated by integrin; response to pain; regulation of axonogenesis; signal transduction; neuron maturation; protein amino acid phosphorylation; enteric nervous system development; retina development in camera-type eye; ureteric bud development; embryonic epithelial tube formation; neuron adhesion; homophilic cell adhesion; neural crest cell migration; transmembrane receptor protein tyrosine kinase signaling pathway; positive regulation of cell migration

Disease: Multiple Endocrine Neoplasia, Type Iib; Multiple Endocrine Neoplasia, Type Iia; Thyroid Carcinoma, Papillary; Hirschsprung Disease, Susceptibility To, 1; Thyroid Carcinoma, Familial Medullary

Research Articles on RET

Similar Products

Product Notes

The RET ret (Catalog #AAA3200302) is an Antibody produced from Rabbit and is intended for research purposes only. The product is available for immediate purchase. The RET antibody - C-terminal region reacts with Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Zebrafish and may cross-react with other species as described in the data sheet. AAA Biotech's RET can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Researchers should empirically determine the suitability of the RET ret for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: Synthetic peptide located within the following region: EMKLVHRDLA ARNILVAEGR KMKISDFGLS RDVYEEDSYV KRSQGRIPVK. It is sometimes possible for the material contained within the vial of "RET, Polyclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.