Rabbit MASP2 Polyclonal Antibody | anti-MASP2 antibody

MASP2 antibody - N-terminal region

Cat. Num. AAA3205921

• Gene Names: MASP2; sMAP; MAP19; MASP-2; MASP1P1
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Applications: Immunohistochemistry, Western Blot
• Purity: Affinity Purified
• Synonyms: MASP2; Polyclonal Antibody; MASP2 antibody - N-terminal region; anti-MASP2 antibody

• Host: Rabbit
• Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat, Zebrafish
• Clonality: Polyclonal
• Purity/Purification: Affinity Purified
• Form/Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Sequence: Synthetic peptide located within the following region: FPGEYANDQERRWTLTAPPGYRLRLYFTHFDLELSHLCEYDFVKLSSGAK
• Sequence Length: 686

• Applicable Applications for anti-MASP2 antibody: Immunohistochemistry (IHC), Western Blot (WB)
• Homology: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rat: 100%; Zebrafish: 77%
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MASP2
• Preparation and Storage: For short term use, store at 2-8 degree C up to 1 week. For long term storage, store at -20 degree C in small aliquots to prevent freeze-thaw cycles.

Immunohistochemistry (IHC)

(Rabbit Anti-MASP2 AntibodyFormalin Fixed Paraffin Embedded Tissue: Human Adult LiverObserved Staining: Cytoplasm in hepatocytes, weak signal, wide tissue distributionPrimary Antibody Concentration: 1:100Secondary Antibody: Donkey anti-Rabbit-Cy3Secondary Antibody Concentration: 1:200Magnification: 20XExposure Time: 0.5 - 2.0 secProtocol located in Reviews and Data.)

Western Blot (WB)

(WB Suggested Anti-MASP2 Antibody Titration: 0.2-1 ug/mlELISA Titer: 1:62500Positive Control: OVCAR-3 cell lysateMASP2 is strongly supported by BioGPS gene expression data to be expressed in Human OVCAR3 cells)

Related Product Information for anti-MASP2 antibody

This is a rabbit polyclonal antibody against MASP2. It was validated on Western Blot using a cell lysate as a positive control.

Target Description: The Ra-reactive factor (RARF) is a complement-dependent bactericidal factor that binds to the Ra and R2 polysaccharides expressed by certain enterobacteria. Alternate splicing of this gene results in two transcript variants encoding two RARF components th

Product Categories/Family for anti-MASP2 antibody

Polyclonal; Signal Proteins; Lymphocyte Signaling; Tissue Specific & Cell Marker

NCBI and Uniprot Product Information

• NCBI GI #: 21264363
• NCBI GeneID: 10747
• NCBI Accession #: NP_006601
• NCBI GenBank Nucleotide #: NM_006610
• UniProt Accession #: O00187
• Molecular Weight: 27kDa
• NCBI Official Full Name: mannan-binding lectin serine protease 2 isoform 1 preproprotein
• NCBI Official Synonym Full Names: mannan binding lectin serine peptidase 2
• NCBI Official Symbol: MASP2
• NCBI Official Synonym Symbols: sMAP; MAP19; MASP-2; MASP1P1
• NCBI Protein Information: mannan-binding lectin serine protease 2
• UniProt Protein Name: Mannan-binding lectin serine protease 2
• Protein Family: Mannan-binding lectin serine protease
• UniProt Gene Name: MASP2
• UniProt Synonym Gene Names: MASP-2
• UniProt Entry Name: MASP2_HUMAN

NCBI Description

This gene encodes a member of the peptidase S1 family of serine proteases. The encoded preproprotein is proteolytically processed to generate A and B chains that heterodimerize to form the mature protease. This protease cleaves complement components C2 and C4 in order to generate C3 convertase in the lectin pathway of the complement system. The encoded protease also plays a role in the coagulation cascade through cleavage of prothrombin to form thrombin. Myocardial infarction and acute stroke patients exhibit reduced serum concentrations of the encoded protein. Alternative splicing results in multiple transcript variants, at least one of which encodes an isoform that is proteolytically processed. [provided by RefSeq, Feb 2016]

Uniprot Description

MASP2: Serum protease that plays an important role in the activation of the complement system via mannose-binding lectin. After activation by auto-catalytic cleavage it cleaves C2 and C4, leading to their activation and to the formation of C3 convertase. Defects in MASP2 are the cause of MASP2 deficiency (MASPD). MASPD is a disorder that results in autoimmune manifestations, recurrent severe infections, and chronic inflammatory disease. Belongs to the peptidase S1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Protease; Secreted, signal peptide; EC 3.4.21.104; Secreted

Chromosomal Location of Human Ortholog: 1p36.3-p36.2

Cellular Component: extracellular region

Molecular Function: peptidase activity; protein binding; serine-type endopeptidase activity; complement component C4b binding; calcium ion binding; calcium-dependent protein binding

Biological Process: innate immune response; proteolysis; complement activation, lectin pathway; complement activation, classical pathway; complement activation

Disease: Masp2 Deficiency